KEGG   Prochlorococcus marinus MIT 9211: P9211_01291Help
Entry
P9211_01291       CDS       T00616                                 

Gene name
hemD
Definition
uroporphyrinogen III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pmj  Prochlorococcus marinus MIT 9211
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    P9211_01291 (hemD)
Enzymes [BR:pmj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     P9211_01291 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
127558..128406
Genome map
AA seq 282 aa AA seqDB search
MGVYKLITSKFICIAMNFDKSFSLKDKTIVITRSQDQQVEARRSFEMMGANVLELPALVI
GPPDDWRPLDDALSELETFHWIIFSSSNGVKAVESRLSLTGRSLSSRPSGLKIAAVGQKT
AKSLEIYGVEADFVPPKFVADSLIKNFPVSGLGLRMLFPRVQSGGRPILTEAFRDAGVKV
VQVSAYESRCPEEIPGETVDALDNGKVDVIAFTSSKTVVHTAQLMSKYFESKWQKKLLGI
KLVSIGPQTSISCKKYFDRIDQEADPHDLEGLVCACIAATKN
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgggagtttataaattaattaccagcaaatttatatgcatagctatgaattttgataaa
agcttttctctaaaagacaaaacaattgttattacaagatctcaagatcaacaagttgag
gctcgtagatcatttgaaatgatgggtgcgaatgtcttagagcttcctgctctagttatt
ggcccacctgatgattggcgacctcttgatgatgctttgtctgagttagagacttttcat
tggattattttttccagtagcaatggagtgaaagctgttgagagtagattgtctctcact
ggtcgttccttgtcttcacgaccaagcggattaaagattgcagcagtgggtcagaaaaca
gctaagtctttagagatatatggagtggaagctgactttgtacctccaaaattcgtggca
gacagtttgattaagaattttccagtgtcgggattgggattaaggatgttattccctaga
gtgcaaagtggtggtagacctattttgacggaagcctttagagatgcaggtgtaaaagtt
gttcaagtatctgcatatgaatcacgatgtccagaggagattccaggagaaacagttgat
gctttagataatggaaaggtagatgtaattgctttcacaagtagcaaaactgtagtgcat
acagctcaattaatgtctaaatattttgaaagtaaatggcagaaaaagctcttaggaatt
aaattagtttctataggtcctcagacaagtattagctgtaaaaaatattttgatagaatc
gatcaagaagctgatccacatgatttagaaggtttggtttgtgcttgtattgcagctact
aaaaattaa

DBGET integrated database retrieval system