KEGG   Prochlorococcus marinus MIT 9211: P9211_01811Help
Entry
P9211_01811       CDS       T00616                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pmj  Prochlorococcus marinus MIT 9211
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    P9211_01811 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    P9211_01811 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    P9211_01811 (trpB)
Enzymes [BR:pmj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     P9211_01811 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
complement(174061..175311)
Genome map
AA seq 416 aa AA seqDB search
MTSTLPSQPKDMELANSSRPSVHGRFGRFGGQYVPETLMPALAELEKKAAEAWQDSSFTN
ELSHLLKTYVGRATPLYEAKRLSQHYMSREGGPRIWLKREDLNHTGAHKINNALGQALLA
IRMGKKRIIAETGAGQHGVATATVCARFGLECVIYMGQEDMERQALNVFRMKLLGAKVQS
VTAGTATLKDATSEAIRDWVTNVESTHYILGSVAGPHPYPMLVRDFHSVIGEETKQQCKE
AFGRSPDVLLACVGGGSNAMGLFHSFIEDLSVKMIGVEAAGDGVNTKRHAATITQGSVGV
LHGAMSLLLQDSDGQVQEAHSISAGLDYPGVGPEHSYLNEIGRAEYVAVTDKEALNALEL
VSKLEGIIPALETAHAFAWLDTLCPSLAPGTEIVINCSGRGDKDVNTVAKKMGFEI
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
gtgacaagcacgctaccctcgcaaccaaaggatatggaactcgcaaacagttcccgacca
tcggtccatggacgatttggtcgatttggaggtcaatatgtgcctgaaactcttatgcca
gctcttgctgaactagagaaaaaagctgccgaagcatggcaagattcttcattcacaaat
gaactatctcatttattaaaaacctacgtcggtcgagcaacccctttatatgaagcaaag
agattaagccagcactacatgagcagagaaggagggccaagaatttggctaaagcgagaa
gatctcaatcacaccggggctcacaaaatcaataatgctctaggacaagctcttctagca
ataagaatgggcaaaaaaagaatcattgcagagacaggtgctggccagcatggagttgca
acagcaacggtatgtgcacgatttggactggaatgcgtcatatatatgggtcaagaagat
atggaaagacaagctctaaatgtatttagaatgaaactactaggagcaaaagttcaatcg
gtcacagctggtacagccactttaaaagatgcaacaagtgaggcaattcgcgattgggtt
actaatgtcgaatcaactcattacatccttggatcagtagcaggcccacatccttatcca
atgttggttagagattttcattcagtcattggagaagagactaaacaacaatgcaaagag
gcttttggccgatcacctgatgtactactggcatgcgtcggaggaggttcaaatgcgatg
ggattattccattcattcatagaagatctttcagtaaaaatgattggtgttgaagctgct
ggagatggggtaaataccaaacgccatgctgcaacaatcacccaagggagtgtaggagta
cttcatggggctatgagccttcttcttcaagacagtgatggacaagttcaagaagcccat
tcaattagtgctgggcttgattacccaggcgtaggacctgaacatagctatctgaatgaa
ataggtcgggcagaatatgtagctgttacagataaagaagctttaaatgcccttgaacta
gtcagcaaattagaaggaattattcctgccttagaaacagcccatgcttttgcatggcta
gacacactttgcccttctcttgccccaggtactgaaatagttattaattgctctggtcga
ggagataaagatgtcaatactgttgcaaaaaaaatgggctttgaaatttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system