KEGG   Prochlorococcus marinus MIT 9211: P9211_03141Help
Entry
P9211_03141       CDS       T00616                                 

Gene name
chlD
Definition
protoporphyrin IX magnesium chelatase subunit ChlD (EC:6.6.1.1 6.6.1.2)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
pmj  Prochlorococcus marinus MIT 9211
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    P9211_03141 (chlD)
Enzymes [BR:pmj01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     P9211_03141 (chlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
297527..299599
Genome map
AA seq 690 aa AA seqDB search
MKTDARAFPLAAITGHGTLKLALMLAAVDPGLGGVIIAGGRGTGKSVLARGLHELLPPIE
VLDLDLQKDSEYLRPVGLNLDPHLPNEWDDVTNQIINNHKRFLDDQDNFELPTKVIKAPF
IQVPLGITEDRLVGSVDVASSLASGNAVFQPGLLAEAHRGVLYIDELNLLDDGIVNLMLA
AVGSGENLIEREGLSLSHPCRPLLIATYNPEEGAVRDHLLDRFAIVLSADQAISNIQRVE
ITQSSIAFAQSSEDFLNTWSEATEAMATQLLLARQWLPDVQITKEQIEYLVNEAIRGGVE
GHRSELYAARVAKAHAALCGRDKVEAEDLQVAVRLVIAPRALQLPPTDEQMEPPPPEDQP
PPPDQSQEDDLEDQDSEDEDEDDTPEDQSSPPIPEEFMLDPEACAIDPDLLLFSSAKSKS
GNSGSRSAVFSDNRGRYVKPIIPRGPVSRIAVDATLRAAAPYQKARREREPSRKVIVEEG
DLRAKLLQRKAGALVIFLVDASGSMALNRMQSAKGALIRLLSEAYENRDEVSLIPFRGEQ
ADVLLPPTRSITAAKRRLETMPCGGGSPLAHGLTQAARVGANALSTGDLGQVVVVAITDG
RGNVPLGVSLGQPQIEGEDPVDLKQEVLDVASRYRSLGIKLLVIDTERKFIASGMGKDLA
EAAGGKYVQLPKASDQAIASIAMDAIGEVK
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgaagactgatgctcgagctttccctttagctgcaataactggtcatgggacgctgaag
cttgcattgatgctcgcagcagttgatcctggtctaggaggggtgattattgcaggaggg
agaggcacagggaagtctgtcttagctagaggattacatgagcttttgccacctatagaa
gttttagatcttgatcttcagaaagactcggaatatttacgaccagttggattaaaccta
gatccacacttgcctaatgaatgggatgacgttactaaccaaataattaataatcataag
aggtttttagatgatcaagataactttgaattgcctacaaaagttattaaggcccctttt
atccaggtcccattaggtattacggaagacagactggttggttcggtagatgttgcatct
tcacttgcatcaggtaatgcagtttttcagcctggtttgttggctgaggctcacagaggt
gttctttatatagatgaattgaatcttttggatgatgggattgtcaacttaatgcttgct
gcagtgggatcaggtgagaatttaattgaaagagagggtttgagtcttagtcatccatgc
cgcccgctcttgattgctacttataaccctgaagagggtgcggttcgtgatcacttgcta
gataggttcgccattgtactatcagcagatcaggctatttcgaatattcaaagggtagaa
attacacaatcatctattgcttttgctcaatcgagcgaagattttttaaacacctggtct
gaagcaactgaagctatggctactcagttgctattggctaggcaatggctacctgatgtt
caaataactaaagagcagattgaatatttagtgaatgaagcaataagaggaggtgtggaa
ggacatcgttctgagttatacgctgctcgtgtggcaaaagcacatgcagctctttgtggt
agagataaggttgaagcggaagatttacaagttgctgttcgccttgttatagctcctagg
gcgctccaattgcctcccactgatgagcaaatggagccaccgcctcctgaggatcaacct
cctcctcccgatcaatcgcaagaggatgacttggaggatcaagattctgaagatgaggat
gaagatgatactcctgaagatcagtcgtcacctcctatccccgaagaatttatgctggat
ccggaggcttgcgctattgaccctgatttattgcttttctcttctgctaaatcaaaaagt
ggtaacagtggtagccgatctgctgtttttagtgataatcgtggtcgctatgttaagccg
attattcctcgaggaccagtttcaagaattgcagttgatgcaacgttaagggcagcagcc
ccatatcagaaagctcgtcgtgagagagaaccttcaagaaaggtaattgttgaggaagga
gatttgcgagcgaagcttcttcaaaggaaagcaggagccttagtaatttttctggttgat
gctagtggatcaatggcattaaatcgtatgcagagtgctaaaggagcattgattagattg
ctctcagaagcttatgaaaatagagatgaagtttctttgattccatttagaggagaacag
gcagatgttttgttaccgccaaccagatctataactgcagcgaaacgacggcttgagact
atgccttgcggcggtgggtccccacttgcacatggcttgacgcaagctgcaagagttggt
gctaatgctctctccacgggagatctaggacaggttgtagtagtggcaatcactgacgga
agaggaaatgtgcctttaggggtatccttggggcaacctcagatagagggagaagatcct
gttgatttaaaacaagaagttttagatgtagctagtcgctatagaagtttaggaattaag
ttattggtgattgatacagaaagaaaatttattgcaagtgggatgggtaaagatttagct
gaggctgcaggaggtaagtatgtgcaattaccgaaagccagtgatcaggcgattgcgtca
attgctatggatgctattggtgaagtgaagtga

DBGET integrated database retrieval system