KEGG   Prochlorococcus marinus MIT 9211: P9211_03261Help
Entry
P9211_03261       CDS       T00616                                 

Gene name
psbJ
Definition
(GenBank) photosytem II PsbJ protein
  KO
K02711  
photosystem II PsbJ protein
Organism
pmj  Prochlorococcus marinus MIT 9211
Pathway
Photosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmj00001]
 Metabolism
  Energy metabolism
   00195 Photosynthesis
    P9211_03261 (psbJ)
Photosynthesis proteins [BR:pmj00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other common subunits
    P9211_03261 (psbJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
UniProt: 
Position
306628..306822
Genome map
AA seq 64 aa AA seqDB search
MSKLRGPDGRIPDRLPDGRPAVSWERRWTEGTLPLWLVATAGGIAVIFVLGIFFYGSYTG
VGSA
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaattaagggggcctgatggccgaattccagacaggctgcctgatggccgtcca
gctgtttcttgggaacgacgctggacagaaggaactttacctttatggcttgtcgctact
gcaggcgggatagcagtaatttttgttctgggtatctttttctacggttcttataccggt
gttggttcagcctaa

DBGET integrated database retrieval system