KEGG   Prochlorococcus marinus MIT 9211: P9211_04111Help
Entry
P9211_04111       CDS       T00616                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pmj  Prochlorococcus marinus MIT 9211
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pmj00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pmj00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
386313..387830
Genome map
AA seq 505 aa AA seqDB search
MSHSLHSLLKAIGLDVPIDLQDPEIKNISSDSRCVKKGDLFFGLPGQKDNGGAFCNEAFL
AGAVAAVVGDSARDCIPHDKKNLVVVVPDPVSQWMGEIASVFWGKPSLEMALIGVTGTNG
KTTTTHLIEHLSKSSGKATALLGTLINRWPKYSEQSIHTTSFGDTLNAQLSQIVASGASL
CAMEVSSHALSQRRVAGLYFSGAIFTNLTQDHLDYHKSMEAYFEAKALLFQSYLIKDGQA
RAVVNIDDQWGFRLAKRLGRNCWKSSLDLKNIQSVRPELFITGIKMTAAGAEGFIHTPFG
EGPFMTPLIGRFNLMNLLQSIGVLLQQGFKLDTLLHATATFSGVPGRMEQVKVPVKSDSL
PMPIVLVDYAHTPDGLKNALKAVRPFVSGKLICVFGCGGDRDKSKRSYMGEIAAEISDIV
IVTSDNPRTEDPMAIIEDILSGIPTTFEAIVELDRCKAIEMSILHAKSNDLIIIAGKGHE
DYQILGDKKIYFNDKEAAIEALEKR
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacagtctccattctctcttaaaggctatcggattagatgtcccaattgatttg
caagatcctgaaataaaaaatatctctagtgattctcgctgcgtaaagaaaggagatttg
ttttttggacttcctggtcaaaaagataatggaggggctttctgtaatgaggctttttta
gctggtgctgtggcagcggtggtgggagattctgcaagagattgtatacctcatgataag
aaaaacttagtagtagttgtacctgacccagtaagtcaatggatgggcgagattgcttct
gtgttttggggcaaaccttctttagagatggctttaattggtgtaactggaactaatggg
aaaacgactacgactcatttgattgaacaccttagtaagagttcagggaaagcaactgca
ttattagggactttaatcaatcggtggcctaagtactccgagcagtctattcataccact
tcatttggagacactttgaatgcccagctttctcaaattgtcgcctcaggggcttcgtta
tgcgcgatggaggttagttctcatgccctttcgcagagacgtgttgctgggttgtatttc
tctggcgcgatatttacaaaccttactcaggaccatctggattatcacaaatctatggag
gcttattttgaggctaaggcacttttgtttcaatcgtatttaattaaagatggtcaggca
agggcagtagtgaacattgatgatcaatggggctttcgcttggcaaaacgattgggaagg
aattgttggaagtcttctttagatcttaagaatattcaatctgtcaggcctgaattattt
atcacaggtataaaaatgactgctgcaggagcagaaggttttattcatactccttttgga
gagggccctttcatgacgcctttaatagggcgatttaatttgatgaacttgcttcaatca
attggagtacttcttcagcaaggatttaaattagatacactcttgcacgcaactgctact
ttctcaggagttccaggacggatggaacaggtgaaagtccctgttaaaagtgacagcctt
ccgatgcctattgttttagtggattacgcacatacaccagatggattaaaaaatgcatta
aaagctgttaggccttttgtttctggaaaacttatttgtgtatttggatgtggtggtgat
agagataaaagcaagaggtcttatatgggtgaaatagcagctgaaatatcagatatcgta
atagtaacttcagataacccaaggactgaagatcctatggcaattattgaagatattctt
tctggaatacctactacctttgaggcaatagttgagttggatagatgtaaagcaattgag
atgtctatattacatgcaaaatctaacgatttaatcattattgcagggaagggacatgaa
gattatcagatccttggggataaaaaaatctatttcaatgacaaggaagcggcaatagaa
gcactagaaaaacgatag

DBGET integrated database retrieval system