KEGG   Prochlorococcus marinus MIT 9211: P9211_04671Help
Entry
P9211_04671       CDS       T00616                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.12 2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pmj  Prochlorococcus marinus MIT 9211
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pmj00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    P9211_04671 (gmk)
Enzymes [BR:pmj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     P9211_04671 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
439929..440486
Genome map
AA seq 185 aa AA seqDB search
MTSMSSLIVITGPSGVGKGTLVEKLLERNSSLWLSISATTRSPREGEVEGKNYFFLEPKR
FSEVKEQGGFLEWAEFAGNFYGTPKKQIDEKISQGKKVLLEIELEGARQVRKNCDKSFQI
FIAPPSFEELEQRIRGRGTDSENAIKRRLARAKEEINAIKEFDAVVINDHIELALLEIER
LVKAS
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgacttcaatgagctctcttattgtaattacaggtccaagtggagttggtaaaggaact
ttagtagaaaagttacttgaaagaaatagttcactttggctttctatatctgcaactact
cgctccccaagggaaggggaagttgagggtaaaaactatttctttttagaacctaaaagg
tttagcgaggtgaaagaacaaggtggctttcttgaatgggcagaatttgcaggaaatttc
tatggaacgcctaaaaaacaaattgatgaaaagatttcccaaggtaaaaaagtcttgctt
gaaatcgaactcgaaggagctcgccaagttagaaaaaattgtgataaatcattccaaata
ttcatagctcctcctagctttgaggaacttgagcaaagaattagaggtaggggaactgat
tctgagaacgctattaaacggcgcttggctagggcaaaagaagaaataaatgcaataaag
gaatttgatgccgtggttataaatgaccacattgaattggctctattagaaatagaaaga
cttgttaaagcttcttaa

DBGET integrated database retrieval system