KEGG   Prochlorococcus marinus MIT 9211: P9211_05751Help
Entry
P9211_05751       CDS       T00616                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pmj  Prochlorococcus marinus MIT 9211
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    P9211_05751 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    P9211_05751 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    P9211_05751 (trpA)
Enzymes [BR:pmj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     P9211_05751 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
538547..539362
Genome map
AA seq 271 aa AA seqDB search
MSNQSVKNSSISQCFAKLKKEGRIALMPFVMAGDPDLQTSAEILLKLQEKGADIIELGIP
YSDPLADGPIIQLAASRALSSGTSPGRVLEMLDSLRGKLTIPLVLFTYSNPLLNRGMERF
CDEASAAGAAGLVVPDLPLEEADKLSPIASEKGLDLVLLVAPTTPHERMRRIFSKSNGFT
YLVSVTGVTGERSGLENRVQSLIKQLKEFGPSPVAVGFGISDSKDVAQVKNWGGDGAIVG
SALVKRISNSAPGCAVDDAGNFCSELRKAAG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaatcaatctgtaaaaaactcaagcattagccaatgctttgcaaagttaaagaaa
gaaggacgtattgcattaatgccttttgttatggctggtgacccagacttacaaacatcg
gcagaaattttgttaaagctacaggaaaaaggagctgacattattgaattgggcattcca
tatagtgatccacttgcagacggtccaataattcagttagcagcatcgcgtgcactttct
tcgggtacttcgccaggacgagttttagaaatgttggatagtttgaggggaaaactaact
attcctttagtgctttttacttatagcaatcctttgcttaatcgcggtatggaacgtttt
tgtgatgaggcttctgctgcaggagctgcaggtttggttgtacctgatctgccattggaa
gaagccgataaattgtctccaattgcttcagaaaaagggctagatttggttcttttagtt
gcacctaccacacctcatgaaagaatgaggaggatatttagcaaaagcaatggttttact
tatctggtaagtgttactggtgttactggagagcgttctggattagaaaatcgtgttcag
tctcttattaaacaattaaaagaatttggcccaagtcctgttgctgttggttttggaatt
tccgactctaaagatgttgctcaagttaagaattgggggggcgacggagcaattgttggt
agcgcattagtaaaaaggatttcaaattcagctcctggatgtgcagttgatgatgctggt
aatttttgtagtgagctgcgtaaagcagcaggttaa

DBGET integrated database retrieval system