KEGG   Prochlorococcus marinus MIT 9211: P9211_06751Help
Entry
P9211_06751       CDS       T00616                                 

Gene name
amyA
Definition
glycoside hydrolase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
pmj  Prochlorococcus marinus MIT 9211
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:pmj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    P9211_06751 (amyA)
Enzymes [BR:pmj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     P9211_06751 (amyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
592932..594668
Genome map
AA seq 578 aa AA seqDB search
MEQQLVRLSELLNEVYREHSAEEIDYMWSQLLQILNQHSDKRDNYAELSELWNSSSAVLI
TYADGVYKSGEPTLKTLKDLIDLHLNDFASVIHVLPFLCSTSDGGFAVSDFEKLETRFGE
WDHLKALSKNHILMADLVLNHVSSSHPWVQQFIQSKEPGSKYILSPSSSENWEDVTRPRN
TSLFTNLSTTKGKKDVWTTFGPDQIDINWKEPYVLIEFLRLIIRYIDSGIKWIRLDAVGF
IWKEPGTTCLHRNEVHKIVKALRIQINELINSSVLITETNVPEKENVSYLSSGDEAHLAY
NFPLPPLLLESLITNKADLLNNWLSSWPELPKNTGFLNFTASHDGVGLRALEGLMDQKRI
RELLIACEKRGGLISHRRMSNGEDQPYELNISWWSAMADKGRDTSLFQFERFLLSQLFVM
ALKGVPAFYLQALMASENDLTTFAKSGQRRDLNREKFEANTLRIKLEDEKSHPSRNLTSL
KKAMQVRRKLNAFHPNQPMKCLSKSRSDLVIISRGEGNETIWALHNMTNSKLCFSLSEGL
NVNGESTVSWDDCLNDYKRHQNRIDLHPYSVHWLMKSN
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggaacagcaactagtgagattgagtgaattactcaatgaagtttacagagaacactct
gcagaagaaattgattatatgtggtcacaattgctgcagattttgaatcagcatagtgat
aaacgagataattatgctgaactctccgaactttggaactcttctagcgccgttttgatt
acttatgctgatggtgtatacaagtcaggagagccaactttaaagacccttaaagattta
atcgatttgcatttaaatgactttgcatcggttatacatgtcttgccttttttgtgttcc
acaagtgatggtgggtttgctgtatcagattttgagaaattagaaacacgttttggcgaa
tgggatcatttaaaagctctctcgaagaatcacatattgatggcagacttggttctaaat
catgtttcatcttctcatccatgggtccaacaatttattcaatctaaggagcctgggagt
aaatatattctttccccttcatcatctgaaaactgggaagatgttactaggccaaggaat
acttctctttttactaacctttctactactaaaggtaagaaagatgtttggacaacattt
ggtccagatcaaattgatattaattggaaagagccatatgttttgatagaatttttaaga
ttaattattagatatatagattctggaataaaatggattcgacttgatgccgtcggcttt
atatggaaagagccaggtacaacatgtttgcacagaaatgaagttcataagatagttaag
gcattaagaattcagattaatgaacttataaactctagtgttttaattactgaaactaat
gttccagaaaaagagaatgtttcataccttagttcaggcgatgaagcgcatcttgcatat
aactttcctctccctccccttttactggaaagtttaattaccaataaagcagatttactt
aacaattggttatcctcatggcctgagttgcctaaaaacacagggtttttaaactttacg
gcttcccatgacggtgttgggctaagagccttggagggtttaatggatcagaaaagaatt
cgtgaattattaatagcttgtgagaaaagaggaggtttaatcagccatagaagaatgtct
aatggtgaggatcaaccttatgaattaaatattagttggtggagtgcaatggcagataaa
ggaagagatacttccttatttcagtttgagcgctttttattgagtcaactttttgtaatg
gctttaaaaggtgttccagctttttatttgcaggcgttaatggcatcggaaaatgattta
acaacctttgccaaatctggccaaaggagagatttgaatcgtgaaaagtttgaagcaaat
actttacgcatcaaactggaggacgaaaagtcacatccaagtagaaatttaacttctctt
aagaaagcaatgcaggtaagaagaaaattaaatgcttttcatcccaaccaaccaatgaaa
tgccttagtaagagtcgcagtgatcttgtgataatttctcgtggtgaaggtaatgaaact
atttgggcattacataatatgaccaattcaaaactatgcttttctctttcagaaggttta
aatgttaatggagaatctactgtctcttgggatgattgcttaaatgattataagcgacat
caaaatagaatagacttgcatccctactctgttcattggttaatgaaatcaaactaa

DBGET integrated database retrieval system