KEGG   Prochlorococcus marinus MIT 9211: P9211_07121Help
Entry
P9211_07121       CDS       T00616                                 

Gene name
ispE
Definition
(GenBank) Putative 4-diphosphocytidyl-2C-methyl-D-erythritol kinase (CMK)
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pmj  Prochlorococcus marinus MIT 9211
Pathway
pmj00900  Terpenoid backbone biosynthesis
pmj01100  Metabolic pathways
pmj01110  Biosynthesis of secondary metabolites
pmj01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pmj00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    P9211_07121 (ispE)
Enzymes [BR:pmj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     P9211_07121 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ABX08643
CyanoBase: P9211_07121
UniProt: A9B9Y1
Position
623928..624881
Genome map
AA seq 317 aa AA seqDB search
MNKVSSSIAESLKVYASAKINLHLEVLGLRKDGFHELAMVMQSIDLVDEIEITKTNDELI
SLNSDNPELDNGDGNLIIKAAKLIRSRSGLRDLGALIYLRKKIPIGAGLAGGSSDGAATL
VGLNSLWGLNFSNNQLEDMAAELGSDVPFCISGGAQLCFGRGECLEPLDKSDPTLAIVLV
KDPSVSVSTPWAYSRYKQLNESTYLSKEIDFQEKRMALRKASWLRPLNASNPPPLINDLQ
EVVAPATPAVEKALQFLRSLKGVLSVAMSGSGPSCFAIFSDLDQARIALEENQEELRKQC
LEGWCCALNSKGVRFAK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaataaggtctcttcctctatagcagagtctttgaaagtttatgcatcagcaaagata
aatttgcatttagaagttttgggattacgtaaagatggctttcatgagttagctatggtt
atgcaaagcattgatttagttgatgagattgagataactaagacaaatgatgaactgatt
agccttaattcagataatccagagttagacaatggagatggaaatttgattattaaggct
gcaaagctaattcgaagtcgatcaggattaagggatttaggggccttaatttatttaaga
aaaaaaattcctattggcgcaggcttggctggaggttcgagtgacggagcagcaactttg
gtaggtcttaactctctttggggactaaatttctctaataatcagttggaagatatggcg
gctgagcttggttcagatgttccattttgcatctcagggggagctcaattgtgctttggt
cgaggtgaatgcctggaacctttagataaatcagatccaactttggcaatagttcttgta
aaagatccatctgtatctgtgtccactccatgggcctattcaaggtacaagcaattaaat
gagagtacttacttaagcaaagaaattgatttccaagagaagcgaatggctcttaggaaa
gcctcttggttaagaccacttaatgcatcaaaccctcctcctttgattaatgaccttcaa
gaggttgttgcaccagccactccagcggttgagaaagctttgcaattccttcgctcatta
aaaggtgttctttcggtagcaatgagtggatcaggcccaagctgctttgcaattttctct
gatttggatcaggctagaattgctcttgaggagaatcaagaggagcttcgaaaacaatgc
ttagaaggctggtgttgtgctcttaattcgaaaggagtgaggttcgcgaagtga

DBGET integrated database retrieval system