KEGG   Prochlorococcus marinus MIT 9211: P9211_08931Help
Entry
P9211_08931       CDS       T00616                                 

Gene name
pheT
Definition
phenylalanyl-tRNA synthetase subunit beta (EC:6.1.1.20)
Orthology
K01890  
phenylalanyl-tRNA synthetase beta chain [EC:6.1.1.20]
Organism
pmj  Prochlorococcus marinus MIT 9211
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:pmj00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    P9211_08931 (pheT)
Enzymes [BR:pmj01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.20  phenylalanine---tRNA ligase
     P9211_08931 (pheT)
Amino acid related enzymes [BR:pmj01007]
 Aminoacyl-tRNA synthetase
  Class II (U)
   P9211_08931 (pheT)
Transfer RNA biogenesis [BR:pmj03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    P9211_08931 (pheT)
 Prokaryotic Type
    P9211_08931 (pheT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
complement(791933..794437)
Genome map
AA seq 834 aa AA seqDB search
MKASLSWLKELVDTSMDVAEIAEKLSISGFEVEEEIDLGLKVKGIVVGKVEEVLPHPNAD
KLKICRVDIGTKKSLQIVCGARNVRDGVHVLVATEGAYLQPINLKIKKSELRGVLSEGMI
CSLGEIGLESDTDGIEILEDSLLKIPEIGSSPRGILGMDDTILDLAITANRPDGMSMVGL
ARELSAITDSKLNLPKIKSLVEFKIFEPKDLSEEAISSKEIYSLSYLEGVDGKKKSPLWL
KNRLEKAGIRSINAIVDITNYIMLEQGQPLHAFDADKLNILTDKEVTQNDFGVRRAKAKE
TLLALDNNEYELNHESHVITCCDKAIAVAGIIGGKSSSVNEHTKNIWLEGAVFTSTSIRR
SSRKIGIRTDSSSRYEKGISAQITLKAVNRAVELYNDCFKCRVSDGFISKNLTPNNYEIK
LRRDRIHNILGALKVTSSNKSGNKRTSIQDPPDNNYTKRNLTDNEIENSLKKVGCEIKCI
EEGWKVSVLANRSNDLQREIDLIEEIARLIGYDKFDANLPDPIKPGYLRPKQSLERTIRN
CLINNGLQEIVSFSLVPKDETNEQMVAISNPLLTETSHLRTNLWEEHLKVCKRNIDSGKQ
ACWVFEIGNVYTVEKKEIYQKSILSGAITGYRSMELWTNEGKQRDMDYYTARGKITQLTD
RLKINVEDRPLRNDERLHPGRSAELILEGKRFGVFGQINPELANKLNINRSTFLFEVSMD
AMLEAAARRNKWLRSFKEFATVPHMQRDMAVIVSKEYLAGDIIKKIMKTGTPLLESVELI
DRYEGGNIDSGEVSLAFRLTYRKKKETLKETEINPVHDRILKELVQSFKVKPRI
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcttctctctcgtggttaaaggaattagtagataccagtatggatgttgctgaa
attgctgaaaagctttcaatttctggtttcgaagtagaggaagaaattgatcttgggctc
aaggtaaaggggattgttgttggaaaggttgaggaggtgctaccacatccaaatgctgac
aaattaaaaatatgtcgtgtggacataggaacaaagaagtctctccaaatagtctgtggg
gctagaaatgtaagagatggggtacatgtacttgtcgcgacagaaggggcctatctacaa
ccgataaacctaaagataaaaaaaagcgaactgagaggtgtactgagtgaaggaatgatt
tgttcattgggagagattggccttgaatcagatacggatggtatagagattttagaagac
agtttgttgaaaattcctgaaataggctctagcccaaggggaatactggggatggacgac
acaatactggacttagctattacggccaacagaccagatggcatgtcaatggttggcctg
gcacgcgagttgtccgcaataacagactctaaattaaatctcccgaaaattaagtcgtta
gtcgaatttaaaatatttgaaccaaaggaccttagtgaagaggcaatatcatctaaagaa
atatatagcttaagttatttagagggagtagacggtaaaaagaaatctccactttggttg
aaaaatagactagaaaaagctggaattagatctatcaatgcaattgtagatataactaac
tatattatgctggaacaaggtcagccattgcacgcttttgatgctgataagttaaacatt
ttaactgataaagaggttacacagaatgactttggagtgaggagggcaaaagcaaaagaa
acattattggctctagataataacgagtatgagttaaatcatgaatcacatgtaataaca
tgctgtgataaagcaatagcagtggctggtataataggaggcaagagttcgtctgtaaat
gaacatactaaaaatatttggctggaaggagccgttttcacttcaacatcaataagaaga
tcgtctagaaagatcggtattaggaccgattctagtagtagatatgaaaagggtatttca
gctcaaataacattaaaagctgtaaatagagctgttgagttatacaatgattgctttaag
tgtagagtatcagatggatttatttctaagaatttaacgcctaacaattatgagataaaa
ttaaggagagacagaatacataatatacttggagctttaaaagttacaagttctaataaa
agcggaaataagagaacttcaatacaagatccgcctgataataattatacaaaacgaaat
ttaactgacaatgaaatagagaattctctaaagaaagttggatgtgaaatcaaatgtata
gaagaaggttggaaagtatctgtattagcaaatagatctaacgatttacagagagaaatt
gacttaattgaagaaatagcacggttaattggctatgataaatttgacgctaatttacct
gatcctataaagccaggatatcttagaccaaagcagagcttagaaaggacgattagaaat
tgcctaatcaataatggattacaggaaattgtgtctttctcacttgtaccaaaagatgaa
actaatgaacaaatggtagcaatatcaaatccattattgacagaaacaagtcacttaaga
acaaatctatgggaagaacatcttaaagtttgcaagagaaatatagattcaggtaaacag
gcatgctgggtgtttgaaataggtaatgtttacacggttgagaaaaaagaaatttaccaa
aaatctatactttctggagctattacgggatatagatcaatggaattatggacaaatgag
ggaaagcagagggatatggactactacactgctcgagggaaaataactcagttaactgac
cgactaaaaattaatgtagaagatagaccattgagaaatgatgaaagattacatccagga
agatcagctgaactaattcttgagggaaaaagatttggggtatttggacaaataaaccct
gagcttgccaacaaattaaatataaataggtctacatttcttttcgaggtgtctatggat
gcaatgctagaagctgcagcgaggaggaacaaatggttgagatcatttaaagaatttgca
actgtgcctcatatgcaaagggatatggctgtaattgtatctaaagagtatctagcagga
gacataataaaaaaaataatgaaaactggtaccccacttcttgaaagcgtagaactgatt
gacagatatgaaggtgggaatattgacagcggagaagttagtcttgcttttaggcttacc
tatagaaagaaaaaggagaccttaaaggaaacagagatcaatcctgttcatgatcggata
ctgaaagaactcgtacagagtttcaaagtaaaacctcgaatctaa

DBGET integrated database retrieval system