KEGG   Prochlorococcus marinus MIT 9211: P9211_09381Help
Entry
P9211_09381       CDS       T00616                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pmj  Prochlorococcus marinus MIT 9211
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pmj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    P9211_09381 (tpiA)
   01230 Biosynthesis of amino acids
    P9211_09381 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P9211_09381 (tpiA)
   00051 Fructose and mannose metabolism
    P9211_09381 (tpiA)
   00562 Inositol phosphate metabolism
    P9211_09381 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    P9211_09381 (tpiA)
Enzymes [BR:pmj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     P9211_09381 (tpiA)
Exosome [BR:pmj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   P9211_09381 (tpiA)
  Exosomal proteins of bladder cancer cells
   P9211_09381 (tpiA)
  Exosomal proteins of melanoma cells
   P9211_09381 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
complement(835209..835940)
Genome map
AA seq 243 aa AA seqDB search
MSKTVIAGNWKMHMTCAQARDFISAYLPLIKNVPKGRELVLAPPFTAISTLSEILKGSNV
SLSSQNVHWEDNGAFTAEISPKMLLEHSVSYAIVGHSEPRKYFSESDKQINLRAKSAQAN
GLIPIVCVGETIEQRERGEAERVIRRQVEQGLEETDKKKLIVAYEPIWAIGTGKTCEANE
ANRICGLIRQWANCPEILIQYGGSVKPGNIDEIMAMSDIDGVLVGGASLDPESFARISNY
KVE
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaaaacggtaatcgcaggcaactggaaaatgcacatgacatgtgctcaggcaaga
gattttatatctgcctaccttcctttgattaagaacgttcctaaaggccgagaattagtt
cttgcacctccatttacagctatatcaacattgtctgaaatattaaaaggatccaatgta
tctttatccagtcaaaacgttcactgggaggacaatggagccttcacagcagaaatatct
cccaaaatgctcttagagcattccgtgtcatatgcaatagttggccacagtgaaccacga
aaatatttcagtgagagtgataaacaaataaatctaagagctaaatcagctcaagcaaat
ggcttaataccaatagtttgtgttggtgagactattgaacagagagagagaggagaggct
gaaagggttataagaagacaggtagagcagggtcttgaggaaacagataagaagaagctc
attgttgcttatgagccaatttgggcaattggtacaggtaaaacatgtgaagcaaatgag
gcaaacagaatttgtgggttgataagacaatgggccaattgcccggaaatattaattcaa
tatggtggctcagttaaacctggaaacatagacgagattatggctatgagtgatatagat
ggagttctcgttggaggagcttccctcgatcctgaaagtttcgcaaggatctccaattac
aaagttgaataa

DBGET integrated database retrieval system