KEGG   Prochlorococcus marinus MIT 9211: P9211_10611Help
Entry
P9211_10611       CDS       T00616                                 

Definition
hypothetical protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pmj  Prochlorococcus marinus MIT 9211
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    P9211_10611
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P9211_10611
   00052 Galactose metabolism
    P9211_10611
   00500 Starch and sucrose metabolism
    P9211_10611
   00520 Amino sugar and nucleotide sugar metabolism
    P9211_10611
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    P9211_10611
   00524 Butirosin and neomycin biosynthesis
    P9211_10611
Enzymes [BR:pmj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     P9211_10611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
complement(957543..957995)
Genome map
AA seq 150 aa AA seqDB search
MKKQGELVFGVDITETYIRSVLFDLDSEIFIRKNTEPHSSLMPGAVTVALSQLVESMDPD
SKSNTVGISLSLPVDIIGRIVKGSHELPQWVDVPFVDWLELRLNKNILLVNAKGSLHLNS
GYKCFKRLISHTELSQELAVACLALEHFRI
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacaaggagaacttgtttttggagttgatatcactgaaacatatatcagatcc
gtactcttcgatttagatagtgaaatctttattagaaagaataccgagcctcattcgagc
ctaatgcctggagcagttactgttgcattgtctcaattggtcgaatcgatggacccagac
agtaagtctaataccgtaggaatcagcttgtctctccctgtagatattattggacgaatt
gtaaaaggatcacatgaattacctcagtgggttgatgtccctttcgttgattggcttgag
ttacgccttaataaaaacattctccttgttaacgctaaaggctctcttcacctaaatagt
ggatacaaatgttttaaacgcttgatctctcatacagaattatcgcaagagttagctgta
gcttgcttggctttggaacatttcagaatctaa

DBGET integrated database retrieval system