KEGG   Prochlorococcus marinus MIT 9211: P9211_10891Help
Entry
P9211_10891       CDS       T00616                                 

Gene name
recR
Definition
RecR protein
Orthology
K06187  
recombination protein RecR
Organism
pmj  Prochlorococcus marinus MIT 9211
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmj00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    P9211_10891 (recR)
DNA repair and recombination proteins [BR:pmj03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      P9211_10891 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
991199..991747
Genome map
AA seq 182 aa AA seqDB search
MPGIGPRTAQRLALHLLRQPEERIKAFANALLNARNQVGQCQQCFHLTEGNECEICLNQN
RQRNLICVVADSRDLLALERTREYKGLYHVLGGLISPMDGIGPELLNISPLVKRITSEET
TEVILALTPSVEGDTTSLYLAKLLNAFVKVTRIAYGLPVGSELEYADEVTLARALEGRRT
VE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
ttgcctgggattggccccagaacagcgcaaaggcttgcgttgcatttattgcgtcaacca
gaagaaagaataaaagctttcgccaacgcactgctaaacgcaaggaaccaagttgggcag
tgtcagcaatgtttccacttgacagaaggtaacgaatgtgaaatctgtttaaaccaaaac
agacaaagaaatttgatctgtgttgttgctgattcaagagatcttcttgcgttagaaaga
acccgtgaatataaaggtctctatcatgttcttggagggctcatctcaccaatggatggt
ataggtcctgaattattaaacatttcaccacttgtaaaaagaatcactagtgaagaaacc
accgaggttattctggctcttacacccagcgtagagggagacacaactagtctttacctc
gctaaattactaaatgcctttgtaaaggtaacaagaattgcatacggactgcccgtagga
agtgagcttgaatacgctgatgaagtcactttagcccgagccctagagggacgaaggact
gtagaataa

DBGET integrated database retrieval system