KEGG   Prochlorococcus marinus MIT 9211: P9211_11361Help
Entry
P9211_11361       CDS       T00616                                 

Gene name
chlI
Definition
(GenBank) Protoporphyrin IX Magnesium chelatase, ChlI subunit
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
pmj  Prochlorococcus marinus MIT 9211
Pathway
pmj00860  Porphyrin and chlorophyll metabolism
pmj01100  Metabolic pathways
pmj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    P9211_11361 (chlI)
Enzymes [BR:pmj01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     P9211_11361 (chlI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 AAA_16 MCM AAA_22 Sigma54_activat AAA_29 AAA AAA_18 DUF815 ABC_tran AAA_30 AAA_28 AAA_27 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: ABX09067
CyanoBase: P9211_11361
UniProt: A9BB55
Position
1040861..1041949
Genome map
AA seq 362 aa AA seqDB search
MSSSSKRRVFPFAAVIGQEEMKLALLLNIIDPRIGGVMIMGDRGTGKSTTIRALADLLPG
IDVVQGDPYNSSPNDPDLQSTEVRQLIEQGNEVSTEERQVPMIDLPLGATEDRLCGTIDI
EKALSEGVRAFEPGLLAKANRGLLYVDEVNLLDDHLVDVLLDSAASGWNTVEREGVSVRH
PARFVLIGSGNPEEGELRPQLLDRFGMSVEVRTVREAELRVQVVDQRTAFDDDPDSFISS
VQAKQDSLQKKVVSAQDRLQNVVIDEDLRLKISAICGELDVDGLRGDIVSNRAARALAAF
EGRNEVSEEDVARVITCSLRHRLRKDPLEQIDSGDRVIKAFCNIFERSDEDVANSFELAS
ID
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgagttcatctagtaagcgcagggtattccccttcgcagcagttattggccaagaagag
atgaagctagctcttcttctcaacattattgaccctcgaattgggggagtaatgattatg
ggagatcgtggaacaggcaagtccactacgattcgcgcacttgcggatcttctgccaggc
atagatgtagtacaaggagacccttacaacagctcgcctaatgacccagacttacaaagc
actgaagtcaggcaactaatagaacaggggaatgaggtctccacggaagaacgacaagta
ccaatgattgatcttcctctgggtgcaactgaagaccgactctgcggaacaatagatata
gaaaaagctctatcagaaggagttagagcatttgaaccaggccttttggcaaaggcaaat
cggggtcttttatatgttgatgaagtaaatctactggatgatcacttagtagatgtactc
cttgactctgcagcttcaggctggaacacagttgagagagaaggagtatcagttaggcac
ccagcaagattcgtactaataggctcaggcaaccctgaagaaggagaattaaggcctcaa
ttactagatagatttggcatgagtgttgaagttcgcactgttagagaagcagaactaagg
gtccaagtcgtagatcaaagaactgcttttgacgatgatccagattcattcatttcgtca
gttcaggcaaagcaagattctttgcaaaagaaagtagttagcgcacaggatcgccttcag
aatgtagttattgatgaagatctgagacttaagatttcagcaatttgtggagaattagat
gttgatggtcttcgaggagatattgtttccaatagagcagcaagagctttggctgctttt
gaaggccgtaatgaagtttcggaagaagatgtggccagagtaatcacatgttcattaaga
catcgcctccgcaaagaccctctagagcaaatagattctggagacagggtaataaaagcc
ttttgcaatatcttcgaaaggagtgatgaagatgttgctaatagttttgaactagcttca
atagattaa

DBGET integrated database retrieval system