KEGG   Prochlorococcus marinus MIT 9211: P9211_11481Help
Entry
P9211_11481       CDS       T00616                                 

Definition
pfkB family carbohydrate kinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pmj  Prochlorococcus marinus MIT 9211
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pmj00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    P9211_11481
Enzymes [BR:pmj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     P9211_11481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
1051194..1052036
Genome map
AA seq 280 aa AA seqDB search
MDTYTSKDLPLFPNLKLAVVGHVEWISFIGVKGLPKPGDIIHASNFREEPAGGGAVAAIQ
LGKLTKQTVHFFTSLGKDRNGIESYKKLEDNGLKLHVAWKDEPTRKGISFVDEKGERTIT
VIGKRLQPTSNDSLPWQILDGFDGIFITATDAKGIQLCRNAKNIVATPRVGVQTLKEANI
ELDALVGSALDLAEQIPIMDLYPQPKKQVATEGAQGGYVIPGGRYKAVKLNHKIIDSYGC
GDSFAAGLTAGLAAGWEINKALNLAAKCGAICTTFFGPYI
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggatacctacacatccaaagatttgcctttatttcccaatttaaaacttgcagttgta
gggcacgttgagtggataagtttcataggtgttaaaggtcttcccaagccaggagatatt
attcacgcaagcaactttagagaggaaccagctggaggaggagctgtagcagcaatacaa
ctcggaaagcttactaagcagactgttcatttctttacatcattaggcaaagacagaaat
ggaatagaaagttataaaaaattagaagataatggtcttaagttacatgttgcctggaaa
gatgagccgaccaggaaagggattagtttcgttgacgaaaaaggggaaaggacaataact
gttatcggtaaaagactacaacctacttcgaatgactctttgccatggcaaatattagat
ggttttgatggtattttcataacagctacagacgccaagggtattcaactttgcagaaat
gcaaaaaacattgttgccactcctagagtgggagttcagacattaaaagaagccaatatt
gagctagatgcgttagttgggagtgcactagatttagctgaacaaattccaataatggac
ctgtatcctcaacctaaaaaacaagtggctacagaaggtgctcaaggtggttacgtaatc
cctggaggcaggtataaagcagtcaaactaaatcacaaaataattgactcatatggctgc
ggggatagttttgcagcaggactaactgccgggttagcagctggctgggaaattaacaaa
gccttaaacctagcagcaaaatgtggtgctatatgtacaactttctttggaccatatata
taa

DBGET integrated database retrieval system