KEGG   Prochlorococcus marinus MIT 9211: P9211_12161Help
Entry
P9211_12161       CDS       T00616                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pmj  Prochlorococcus marinus MIT 9211
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmj00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    P9211_12161 (dxr)
Enzymes [BR:pmj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     P9211_12161 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
1095483..1096721
Genome map
AA seq 412 aa AA seqDB search
MLGSTGSIGTQTLQIAEEFPEQFKVVSLTAGRNLTLLIEQIKKHSPEVVALAEECLVQEL
QERLDNINPSEKPKKFPKLFGGPEGLNIAASWDHSDLVVTGIVGCAGLLPTLAAIKAGKD
IALANKETLIAAGPVVLPELKKSGSRLLPADSEHSAIFQCLQGTPWAENARLSTGVPTPG
LRNIQLTASGGAFRDWSIDELRNASVKDATSHPNWSMGKKITVDSATLMNKGLEVIEAHY
LFGLNYNHIEIVIHPQSIIHSMIELGDSSVLAQMGWPDMKLPILYAMSWPNRIETPWKRL
SLPEIGSLTFKSPDTAKYPCMELAYSAGRSGGTMPAVLNAANEEAVAQFLKEKIHFLSIP
KIIESVCEQHKNDLNQNPKLNDVIAVDEWARRVVRENVLTNANRYSMANTAE
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgctgggctccactggttctattggtacccaaactcttcagatagccgaagaatttccg
gagcaattcaaagttgtttctctaacagcaggtcgcaacctaaccctgttaatagagcaa
ataaaaaaacacagtcctgaagtagtcgctcttgcagaagaatgtcttgtccaagagctt
caagaaagactagataatataaatccctcagaaaaacccaaaaaattcccgaaattgttt
ggaggtcccgaaggtctaaacattgcggcttcttgggaccactctgaccttgtcgtcact
ggaatagttggctgtgcaggtcttttaccaacgctagccgcaataaaagccggtaaagat
attgcgctagccaataaagaaactcttatcgcagcagggccagttgtattgccagaatta
aagaaaagtggaagtaggctattaccagctgattccgaacattcagcaatattccaatgc
ctccaaggcacaccttgggccgagaatgcacgtctctcaacaggggtaccaacacctggg
ttaagaaatattcaactcactgcatctggaggtgcttttagagactggtcaatcgatgag
ctgagaaatgcatctgttaaagatgcaacaagtcatcccaactggagcatggggaaaaag
attactgtcgattcagcaactcttatgaataaggggctagaagttatagaagctcattat
ttatttggtctcaattacaaccacatagagattgtcattcatccacaaagcattattcat
tcaatgattgaattgggagattcatctgttttagcccaaatgggttggccagatatgaag
cttccaattctctatgcaatgagctggccaaatagaatagaaactccttggaaaaggcta
agtcttcctgaaatagggagtctaaccttcaaatcaccagacactgctaagtatccatgt
atggaacttgcctattctgctggaagatcaggaggtacgatgcccgccgttctcaatgca
gcgaatgaagaagctgtagcacaattcttaaaagaaaaaattcatttcctaagcattcca
aaaataattgagagtgtttgcgaacaacataaaaatgacttaaatcagaatcctaagctt
aatgatgtaattgccgtggacgaatgggctcgaagagtagttagagaaaacgtactaact
aatgctaatagatattccatggctaacactgcagaatga

DBGET integrated database retrieval system