KEGG   Prochlorococcus marinus MIT 9211: P9211_12791Help
Entry
P9211_12791       CDS       T00616                                 

Gene name
cysQ
Definition
CysQ-like protein (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pmj  Prochlorococcus marinus MIT 9211
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pmj00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
complement(1154006..1154986)
Genome map
AA seq 326 aa AA seqDB search
MYRFPEVGSLDFPKASFSKKSMSSTDCFLPNGVNLEDLLEGLRSLSWGAADILMAYARGS
KPPYGFPMELEIEDNPGGPVSAADLAVNSWLLDGINSKFPTATWKLLSEENAKEEFVEGL
SACNGWIWILDPLDGTKDFIKGTGEYAVHLALVNDHHLKMGVVLIPEKEELWFGVLGEGA
WCENRLGEKRNVKFSNRTQISEMILVASKSHRDKTLSQLMERISPGETKGIGSVGCKVGT
ILRGEADFYISLSGKTAPKDWDMAAPEAVLRAAGGGFTHADGRPLSYNKDNYEQRGCLIV
SHGKNHDLICKLAEDEIKKLDPFFEI
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtatagattccctgaggttggttcgctcgattttcctaaagcttcgttttctaaaaaa
tccatgagttctactgattgttttcttccgaatggggtcaatcttgaagatctattagaa
ggtcttagaagtttgagttggggagctgctgatattttgatggcatatgccaggggaagt
aagcctccttatggttttccaatggaattggagatcgaagataatcctggaggaccggtc
tctgcagctgacttggccgttaatagttggttgcttgatggtattaactctaagtttcct
actgcaacttggaagttattgagtgaagagaatgcaaaagaagaatttgttgaaggactt
tcagcttgtaatggttggatctggatcttagaccctcttgacgggactaaggattttatt
aaaggaacgggagaatacgccgtgcatttggcacttgtgaatgatcatcatttaaaaatg
ggggtcgttttgattccagagaaggaagaattatggttcggagttttaggggaaggcgcg
tggtgtgagaatcggttgggagaaaaaaggaatgtgaaatttagtaatagaacgcaaatt
tcggaaatgattcttgtagcaagtaaaagtcatagagataaaacactgtctcaattaatg
gaaaggatctctcctggagagactaaaggtattggaagtgttggatgcaaagtagggacc
atacttagaggagaagcagatttctatatatctttgtcaggcaaaacagctcctaaagat
tgggatatggcagcacctgaggcagtcctaagggctgcaggaggaggatttacacacgcc
gatggtagacccctttcatacaacaaagataactatgagcaacgaggatgcttgattgtt
agccatggtaaaaaccatgaccttatatgtaaactagctgaagatgaaataaaaaaatta
gaccctttttttgaaatttaa

DBGET integrated database retrieval system