KEGG   Prochlorococcus marinus MIT 9211: P9211_13441Help
Entry
P9211_13441       CDS       T00616                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pmj  Prochlorococcus marinus MIT 9211
Pathway
pmj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pmj01100  Metabolic pathways
pmj01110  Biosynthesis of secondary metabolites
pmj01130  Biosynthesis of antibiotics
pmj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmj00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    P9211_13441 (trpC)
Enzymes [BR:pmj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     P9211_13441 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh ThiG
Motif
Other DBs
NCBI-ProteinID: ABX09275
CyanoBase: P9211_13441
UniProt: A9BBR3
Position
complement(1211830..1212717)
Genome map
AA seq 295 aa AA seqDB search
MEIRRRPPNPKVKVANLEYAIPHEDGEPRNILEKILWEKDREVKVSRERVPLSELKAQIN
NLPQTKDFLGALRQSSTSPAVIAEIKKASPSKGVIRENFDPIEIALAYKLGGATCLSVLT
DKSFFQGGFEVLVQVRKTVDLPLLCKEFIIQPYQIYQARVAGADAVLLIAAILSDQDLLY
LRKVAISLGLTILVEVHDSNELKRVLDLEGFPLVGINNRDLKTFNTDLRTTKEVVKEHKK
RISEQEVLLVSESGLFNSADLEEVSSYGAKAVLVGESLMRQPDIGLALKNLQGFK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggagattcgtcgacgtccaccaaaccctaaagttaaggttgcaaaccttgaatatgct
attccgcatgaagatggtgaacccagaaatattcttgaaaaaatcttgtgggagaaagat
cgtgaagtaaaagtttcaagagagagagttcctctttcggaattaaaggctcagatcaat
aatttgcctcaaactaaagatttcttaggggctttgagacaatcctctacttcaccagct
gttatagcagaaataaagaaagcaagtcctagcaagggagtgattcgcgaaaactttgat
ccaatagaaatagcacttgcttataagttaggaggtgcaacatgcttatcagtgttgaca
gataaaagtttttttcaaggaggctttgaggtacttgttcaagtcagaaagactgttgat
ttaccattgttatgcaaggaattcattattcagccttaccagatttatcaagcaagagtt
gctggtgctgatgcggttttattgattgcagccatactttctgatcaagatcttctttat
ctgagaaaagttgcaattagccttggattaacaatattggttgaagtgcatgactctaat
gagttgaaaagagtactagatttagaaggatttcctctggttggaattaataatcgcgac
cttaagactttcaatactgatttaagaacgacaaaagaagtagtaaaagagcataaaaag
agaatttctgaacaagaggttctattggtaagtgagtctggtttatttaactctgcagat
ctagaagaagttagttcctatggagcaaaggctgttcttgttggtgagtctttgatgaga
caacctgatattggattggcgttaaaaaacttgcaaggatttaagtag

DBGET integrated database retrieval system