KEGG   Prochlorococcus marinus MIT 9211: P9211_13481Help
Entry
P9211_13481       CDS       T00616                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
pmj  Prochlorococcus marinus MIT 9211
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pmj00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pmj00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
1215658..1217040
Genome map
AA seq 460 aa AA seqDB search
MYCMNSVASISNTVAKHHLEVRGSNFLSGQIKISGAKNSALVLMAATLLTEEALFLKNIP
SLTDINVMSELLSSIGVRIERKSNEISLTARDLLQSELPYKLVHALRASFVCAGPLLARI
GEVSIPLPGGCRIGNRPIEEHIRGLEALGASVSIEKGVVKAKLPKNKKKLKGAHIKFNCQ
SVGATETILMAATLAEGRTVLENSAQEPEIQDLANMLNSMGAQIRGAGTKEIIIEGVEKL
NGCNHTVIPDRIEAGTFLIAAAITRSSISLTPVIPEHLEAVFKKLRECGCLINTMGDSVK
ITPNEITAVDVTTSPYPGFPTDLQAPFMALMTTAKGTSKITETVFEKRMQHVSELNRMGS
SIKLLGNTALITGVPQLTGTSLSAGDLRASAAMVLASLSAKGVSKIIGLDYLDRGYERME
DKLKKVGADISREKITISANKNSKEGFKPLTPQSIQQEVA
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgtactgcatgaatagtgtggcttcaatttcaaacacagttgcgaagcatcatttagag
gttcgtggaagcaattttttgtctggacaaataaaaattagcggtgctaaaaactctgca
ttagtactaatggcagcaacattgcttacagaagaggctctttttcttaaaaatatccca
agtcttacagatatcaatgtgatgtcagaactacttagttctataggagtacgcattgaa
cgcaagtcgaatgaaatttctttaaccgctagagacctccttcaatcggaacttccttac
aaattagttcatgctctaagagctagttttgtctgcgctggacctcttcttgcaagaatt
ggagaagttagcatcccattacctgggggatgtcgcatagggaatagacctattgaagag
cacatcagaggtcttgaagctttaggcgcctcagtaagtattgagaaaggagtggtaaag
gcaaaactacctaagaacaaaaagaaattaaaaggagctcatataaaattcaattgccaa
agtgtaggagctactgaaaccatacttatggcagcaactcttgctgaaggacgtaccgtt
ttagagaattctgctcaagagcctgagatccaagatcttgcaaacatgttgaattctatg
ggtgcacaaataagaggcgcagggacgaaagaaattattattgaaggtgtagagaaatta
aacggttgtaatcacactgtcatcccagatcgcattgaagcaggaacatttcttatcgca
gcagcaataactcgatcatccatttctttaacccctgttatacctgagcaccttgaggca
gtcttcaaaaaacttcgtgaatgtggttgcctaattaacaccatgggggattcagtaaaa
atcactccaaacgaaataaccgctgtagacgtaacaacttctccttatccaggattccca
actgatttgcaagctcccttcatggctcttatgacaaccgctaagggcacaagcaaaatc
actgagacagtctttgagaaaagaatgcaacatgtatctgagctaaatcgaatgggaagc
tcaataaagcttttaggtaacacagctttgattacaggagttcctcaattaacaggaaca
tctttatccgcaggtgatttacgtgcatcagccgcaatggttctggcgagtctttcagca
aagggagttagtaagatcataggactcgattaccttgatagaggatatgaaagaatggaa
gataagctaaaaaaagtaggagctgatatttctcgagaaaaaataacaatttctgctaat
aaaaattctaaggaaggctttaagccactaactcctcaaagcattcagcaagaagtggct
tga

DBGET integrated database retrieval system