KEGG   Prochlorococcus marinus MIT 9211: P9211_16101Help
Entry
P9211_16101       CDS       T00616                                 

Gene name
hisD
Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
pmj  Prochlorococcus marinus MIT 9211
Pathway
pmj00340  Histidine metabolism
pmj01100  Metabolic pathways
pmj01110  Biosynthesis of secondary metabolites
pmj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmj00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    P9211_16101 (hisD)
Enzymes [BR:pmj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     P9211_16101 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ABX09541
CyanoBase: P9211_16101
UniProt: A9BCH9
Position
1441389..1442660
Genome map
AA seq 423 aa AA seqDB search
MTALERISNRTCGDGQKKAVLTVEKILERVKKDGDTALIEYTKKFDGFDPDPLEVPLEAI
ERAWEETPKPLQDALITAKHRIQDFHQKQIPKNILFKGIEGETLGRRWQPVQKAGIYIPG
GRASYPSTVLMNAIPASVAGVKEIIMVSPGGSNGLVNQTVLAAAYITGIKTVFRIGGAQA
IGAMAYGTNTIPKVNVISGPGNLYVTLAKKYVYGDVGIDALAGPSEVLIIADNSADVRHI
AADLLAQAEHDPLAATILLTTNSVLAEKIDDEIMEQLEEHPRKEICLKALKDWGLIVICN
DLETCAKLTDYFAPEHLELLLKMPYQVADKINNAGAIFIGAWSPEATGDYLAGPNHTLPT
SGTARFSGALGVETFMKNTSIIEFNKQAFDKNSKAIIELANSEGLHSHAKSIEIRLSKSS
EEI
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgactgccctggaaaggatatccaatagaacttgcggagacggtcaaaaaaaggctgtt
cttacagtagaaaaaatccttgaacgagtaaaaaaggatggggatacagctctgattgaa
tacactaaaaaatttgatggatttgaccctgatccccttgaggttcctttagaagcaata
gaaagagcatgggaagaaactccaaagccacttcaagatgctctaattactgcaaaacat
agaatccaagacttccaccaaaagcaaattccaaaaaatattctttttaaagggattgag
ggtgagacattaggtaggcgatggcaacctgttcaaaaagcaggcatctatattcctgga
ggaagagcttcttatcccagcacagttcttatgaacgcaattcctgcatctgtagcggga
gtaaaagaaattattatggtttctcctggaggttctaatggtcttgtgaatcaaactgta
ctcgctgcggcttatatcacaggaataaaaacagtttttaggataggcggggctcaagcc
attggagcaatggcatatggaacaaacacaattccaaaagttaatgtaataagtggtccc
ggcaatttatatgtcactttggcgaagaaatacgtttatggagatgttggaattgatgct
cttgccggtcccagtgaagtactaattattgccgataatagtgccgatgttcgtcatatt
gctgctgatttacttgcacaagcagagcatgatccattggcagcgacaatcttgctaaca
actaactccgttcttgctgaaaagattgatgatgaaattatggagcagttagaagagcat
ccacgaaaagaaatatgtcttaaggcacttaaagactggggcctaattgtaatttgcaat
gacttagaaacttgtgcaaagttaacagattactttgcacctgagcatctagaattatta
ctaaaaatgccatatcaggtggcggataaaatcaataatgctggtgcaattttcataggc
gcttggagcccagaagctactggagactatcttgctggtccaaaccacacattaccaaca
tcaggaactgcaagatttagtggggctttaggggtggagactttcatgaagaacacttca
attattgaatttaataaacaagctttcgataagaatagtaaggcaattattgagcttgcg
aatagcgaaggacttcatagtcatgcgaagtcaatagagattagactctctaaatcttct
gaagagatttaa

DBGET integrated database retrieval system