KEGG   Prochlorococcus marinus MIT 9211: P9211_16161Help
Entry
P9211_16161       CDS       T00616                                 

Gene name
infB
Definition
(GenBank) Translation initiation factor IF-2 (EC:2.7.7.4 3.6.5.3)
  KO
K02519  
translation initiation factor IF-2
Organism
pmj  Prochlorococcus marinus MIT 9211
Brite
Translation factors [BR:pmj03012]
 Eukaryotic Type
  Initiation factors
   MTIFs
    P9211_16161 (infB)
 Prokaryotic Type
   P9211_16161 (infB)
Mitochondrial biogenesis [BR:pmj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    P9211_16161 (infB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
UniProt: 
Position
1446986..1450327
Genome map
AA seq 1113 aa AA seqDB search
MTSSGKIRIYELSRDLNLENKDVLNAAKKLSIPAKSHSSSISNAEANEIKAFLNKQSNQS
INNKTKQNSSKEILSLKKAGSKPIKDEITKKKANLPPKASAESQSSKPRIETSKAPVAPI
KPIKEPVQKANTSNQSKGVINNLIQPQKPSPLQPKQPKSIHLENNASKQNIEDNNNFQER
SPRTQLVQKPPLPTKNNEPPQQKTSIPKRPITPPARPSKPILDNRSSVKSRPIIEAPRKK
TGPDRNSPVQPRTQNNQNRQRIPNKPGKPPLRGNPPVELVGAPIRRSNKPNNNVKGPRDG
GYRPGPPNRNDPSNQQGHVKRDIKAPIRQRPGMPPGMRKPVAPGELMQLQKPTGRSQPPA
PRRVGAPAPPSQRADSTKDRQGKSPGAKQPVNRPTPATAPKKPSHRPPGSGPTKRRSDWD
DAAKLEALRNKAPQKQRQKVHIIGENDDALTTETSGFAAEQEAMVLSASLARPAKPKSTK
KSNSKATVVTRKRKKESTRQRQRRRAMELRAAREAKQVRPEMIIIPEGNLTVQELADKLS
VESSEIIKSLFFKGITATVTQSLDLSTIETVAEEFGVPVLQDDIEEAATKTAEMLDEADK
DHLIRRPPVVTVMGHVDHGKTSLLDAIRKARVASGEAGGITQHIGAYQVELEHEKKKRKL
TFLDTPGHEAFTAMRARGTKVTDVAVLVVAADDGVRPQTLEAISHARAAKVPIVVAINKI
DKEGASPDRVKQELSEQELVAEEWGGEVVMVPVSAIKGENIDKLLEMVLLVTEVEDLQAN
PDRLAKGTVIEAHLDKAKGPVATLLIQNGTLKSGDVLAAGPVLGKVRAMVDENGIRLKEA
GPSCPVEALGFNEVPTAGDEFEVYPDEKSARAVVGDRASDARATRLAQQMASRRVSLSSM
SGQANEGDLKELNIILKADVQGSIEAILGSLEQLPKDEVQVRVLLSAPGEVTETDVDLAA
ASGAVIVGFNTSMASGAKKAADANSVDVRDYEVIYKLLEDIQLAMEGLLEPDMVEESLGE
AEVRAIFSIGKSAVAGCYITNGKLQRNCKVRVKRGSQIVFEGDLDSLRRNKDVVKDVGSG
FECGVGCDRFANWKEGDIIQGYKLVTKRRTLGP
NT seq 3342 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcagcggcaaaatcagaatctatgagctttctagggatttaaacctggaaaat
aaagacgtgctcaatgctgctaaaaaattatcaataccagcaaaaagtcatagcagctca
ataagcaatgcagaagcaaacgaaatcaaagcattcctaaataagcaatcaaatcagtct
ataaataacaaaaccaagcaaaactcaagcaaagaaatcctttctctaaaaaaagctggc
tcaaaacctattaaagatgaaataactaagaagaaagcaaatctccctcctaaagcctct
gctgagagtcaatcatcaaaaccaagaattgaaacttctaaagcacctgttgctccaatt
aaacctataaaagaaccggttcaaaaagccaatacttcaaatcaatctaagggtgtaatt
aataatttaattcaacctcaaaaaccttcccctcttcaacctaagcaaccgaaaagcatt
catctagaaaataatgcatctaaacaaaatattgaagataacaataattttcaagaaagg
agccctcgcacgcagctagtccaaaaaccgccattacccactaaaaataatgagccccct
caacagaaaacaagtattcccaaacggcctattacacccccagcgcgaccaagcaaacct
attctagacaacaggtctagtgttaaatcacgaccaatcattgaagccccacgcaaaaaa
acaggaccagatagaaattctcctgttcaaccacgaacacaaaacaaccaaaaccgtcaa
cgaatccctaacaaacctgggaagcctcctttaagaggaaaccctcctgtagagcttgtt
ggtgccccgatacgaagaagtaataagcctaacaacaatgtcaaagggccaagagatgga
ggctatcggccaggtccaccaaatagaaatgatccttcaaatcaacaaggtcacgtaaaa
cgagatatcaaagctccaattcgtcaacgcccaggaatgccaccaggcatgagaaagcct
gtcgctcctggagagctaatgcagcttcagaagccaacgggaaggtctcaacctcctgcc
ccccgaagagtaggagcacctgcaccaccttcccaacgtgcagatagcactaaagaccga
caaggaaagtcgccaggggcaaagcaacctgtcaatagaccaaccccagcaaccgcaccc
aaaaagccttctcacaggcctccaggttctggtccaaccaaaagaaggtctgattgggat
gatgcggccaaattagaagctttaaggaataaagcccctcaaaagcaacgtcaaaaagtt
cacattattggagaaaatgacgatgccttaactactgaaacgagcggttttgcagctgag
caggaagctatggttctttctgcaagcctcgcccgacctgcaaagccaaaatcgacaaag
aaatccaattctaaagcaactgtcgtaaccagaaagcgtaaaaaagagtccaccagacaa
agacaaagaagaagagcaatggaacttcgagctgctcgtgaggcaaagcaagttagacct
gaaatgatcattattccagaaggtaatctcacagttcaagaacttgcagataagctcagc
gttgaaagctctgaaatcatcaaatcactattctttaaaggaataacagcaacagtcacg
caatcattagatctatccactatcgaaacagttgcagaagaatttggtgtcccagtatta
caggatgacatagaagaagctgcaactaaaacagctgagatgctcgatgaagcagacaaa
gatcacttaatcagacgaccacctgtagtgacagttatgggccacgttgaccatggcaag
acaagtcttctggatgcaatacgtaaagcaagagttgccagtggcgaagcggggggaatt
acgcaacatataggcgcatatcaagttgagctagaacatgagaagaaaaagcgaaagctg
actttcctcgatactcctggccacgaagcatttacagcgatgcgtgcaagaggaacaaaa
gtgaccgatgtggctgttcttgttgttgctgcagatgacggtgtacggccacaaacccta
gaggcaataagccatgctcgtgctgcgaaagtacccatcgttgtagccataaataagatt
gacaaagaaggtgcatctcctgatcgtgtcaaacaagaattatctgaacaagaattagtt
gcggaagaatggggtggagaggtagtaatggtacctgtcagtgccattaaaggagaaaat
atcgacaagctcttagagatggttttactggtaactgaagtagaagacttacaagcaaat
ccagatcgactcgccaaaggaactgtgattgaagctcaccttgacaaagccaaaggacca
gttgcaacactattaattcaaaatggaactcttaaatctggagatgttcttgctgcaggg
ccagtacttggaaaagtacgagcaatggtagacgaaaatggcatacgtctaaaagaagct
ggtccctcatgcccagtagaagcacttggctttaacgaagtacctacagcaggagatgaa
tttgaggtttatccagatgaaaaatcagcaagagcagtagttggcgatagagcatctgac
gctcgtgcaacacgacttgcccaacaaatggcctcaaggcgcgtatcactttcttcaatg
tcaggccaagccaatgagggagacttaaaagaattaaacatcatactcaaagccgacgta
cagggaagtatagaagccatattaggctcactcgagcaactccctaaagacgaggtacaa
gtaagagtattactatctgcaccaggagaagtaacagaaacagatgtagacctcgcggcc
gcgtctggagcagtaatagtaggctttaacacctcaatggcttctggtgccaaaaaagca
gcagatgctaatagtgttgatgttcgagattatgaggttatatacaagctgctagaagat
attcaactagcaatggaaggcctattagaacctgacatggtcgaagaaagtcttggagaa
gctgaagtccgagccatcttctctattgggaagagtgcagtggcaggctgctatatcacc
aatggtaaattgcaaagaaattgcaaagttcgagtcaaaagaggttctcaaatagttttt
gaaggagatcttgattcattgcgtcgaaacaaggatgttgtcaaagatgtcggcagtgga
tttgaatgtggcgtaggttgcgatagattcgcgaattggaaagagggggatattattcaa
ggctataagctggtgacaaaacgtcgcacactaggcccgtaa

DBGET integrated database retrieval system