KEGG   Prochlorococcus marinus MIT 9211: P9211_17991Help
Entry
P9211_17991       CDS       T00616                                 

Gene name
ole1
Definition
Fatty acid desaturase, type 1 (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pmj  Prochlorococcus marinus MIT 9211
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:pmj01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:pmj01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
1628039..1628983
Genome map
AA seq 314 aa AA seqDB search
MVSSVIGPSAPLRRPVSASKALAASTKLQIQTPINNKNKLKPLGKFERRWGTIIFMFAIH
ALTIFALQPKFWSVQAVSALLVMYWVTACLGVTLGYHRLLSHRSFQVPRWLERFFATCGA
LSCQHGPIDWVGLHRHHHTFSDTDADHHNSNKGFWWSHMGWMFEDVPALGTVPRFTGDLV
KDPYYLFLNQHFLLLQIPLGAFLFWIGTISEVGGWSMVLWGIPLRLVVVYHVTWLVNSAT
HCWGSVAYESGDRSRNNRWVAALTFGEGWHNNHHAFPSSAKQGLQKGQIDLTWEHIRFLK
RLGLARKIRLPMTF
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtggtttccagtgttattggaccaagcgccccattaagaaggccggtttctgcaagtaaa
gctcttgctgcgtctaccaaacttcaaattcaaacacctatcaataataagaataagctc
aagccattagggaaatttgaacggcgctggggaacaattatttttatgtttgcaattcat
gctttaacaatatttgcattacaaccaaaattttggagtgtgcaagctgttagtgcattg
ttagttatgtactgggtaactgcttgtcttggagtcacacttggatatcacagattgcta
tctcatcgttctttccaagttccaagatggcttgaaagattctttgctacttgtggagct
ttaagttgccaacatggtccaattgattgggtaggcctccatcgtcaccatcacactttt
tcagataccgacgcagatcatcacaatagtaataaaggattctggtggagtcatatggga
tggatgtttgaggacgtacctgctttaggcacagtgcctcggtttacaggtgatttagta
aaagatccttattatctatttctaaatcaacattttttacttttgcaaattccactaggc
gcttttcttttttggatagggactattagcgaagtaggtggatggtcgatggttctatgg
ggaatcccgctacgtttagtagttgtttatcacgtcacttggttagttaattcagccaca
cattgttggggaagtgttgcttatgaaagcggggatcgatcaagaaataaccgatgggtc
gctgcactgacatttggtgaaggttggcacaataatcatcacgcatttccaagttctgct
aagcagggacttcaaaaaggtcaaatagatctaacttgggaacatatacgatttctcaag
cgattaggtttggctagaaaaattcggctgcctatgacgttctaa

DBGET integrated database retrieval system