KEGG   Prochlorococcus marinus MIT 9211: P9211_18171Help
Entry
P9211_18171       CDS       T00616                                 

Gene name
speB
Definition
arginase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pmj  Prochlorococcus marinus MIT 9211
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pmj00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
1644642..1645532
Genome map
AA seq 296 aa AA seqDB search
MKINQNLTFNNSEGIFIGSQTNCKDCKIGIYGVPYDGTTSFRPGTRFGPSAIRNISNGIE
SFCPQLNLDLEDLKYVDLGSLDIPFGAPEKVINLVKQATILLMQKGIKPLLLGGEHSITE
GAIAGIVDFHPELIILQLDAHADLRDEWLGSKHNHACVMRRCIEILPSKKIFQMGIRSGT
SKEFKELKEKKRLISHQSGQVAKSLDKAMQPYLGMPIYLTLDLDWFDPSVMPGTGTPEPG
GFLWQDFAAVIEVIKKHNLIAADIVELAPKLDHSEISSILAAKIARSLIMLLSLEK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaatcaaaacctaacatttaataatagtgaggggatatttatcggcagccaa
acaaactgcaaagattgcaagattggcatctacggtgttccttatgatggaacaacatca
tttagaccaggtacgcgcttcggtccatctgcaataaggaacattagcaatggaattgaa
tctttctgcccacaattaaatcttgatcttgaagacttaaaatatgttgatcttggctct
ttagatattccttttggagcaccagaaaaagttataaatctagtaaagcaagccactatt
ctacttatgcaaaaagggatcaaacctttattacttggaggagagcattccattacagaa
ggtgcaatagcaggaatagtagattttcatcctgaactaattattcttcaattagatgcc
catgctgatcttcgagatgaatggttaggttcaaagcataatcatgcttgcgtaatgcgt
agatgcatagaaattttaccaagcaaaaaaatctttcaaatgggtattcgaagcggaact
agtaaggaatttaaagagcttaaagaaaagaaaagattaatttctcatcaaagtgggcag
gttgccaagagtctagataaggcaatgcagccttatctaggcatgcctatttatttaaca
ttagatctcgattggttcgacccaagtgtgatgcctgggacgggaacaccagaacccggt
ggatttttatggcaagactttgcagctgtaatagaggtaattaaaaaacataatttaatt
gctgcagatatagttgaattagctcctaagttagatcattctgaaattagtagtattctt
gccgcaaaaattgctcgaagtctaatcatgttactatcgctagaaaaataa

DBGET integrated database retrieval system