KEGG   Prochlorococcus marinus MIT 9211: P9211_18541Help
Entry
P9211_18541       CDS       T00616                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pmj  Prochlorococcus marinus MIT 9211
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pmj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    P9211_18541 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    P9211_18541 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    P9211_18541 (thrC)
Enzymes [BR:pmj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     P9211_18541 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
1687695..1688801
Genome map
AA seq 368 aa AA seqDB search
MSILKRLPRIFDRSHEYKHWPGLIKAYKKWLPVTDKTPIITLQEGATPLIPLKSINELIG
KNVKIFVKYDGLNPTGSFKDRGMTMAISKAKEDNCEAVICASTGNTSASAAAYAKRGGMK
SFVLIPDGYVAQGKLAQALVYGAEVLAIKGNFDKALNIVQELSNRYPITLVNSVNPYRIQ
GQKTAAFEIIDSIGEAPDWLCIPMGNAGNITAYWMGFEEYYKAGKSKKLPKMMGFQAIGS
APLVFNKTIENPETIATAIRIGNPVNKEKAFIVKGKSKGKFTAVTDKEIIDAYKLLGKEE
GIFCEPASAASIAGLIKLKEEIPPNSTIVCVLTGNGLKDPDCAINNNDASFKNNLEPNSD
EIAKAIGF
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
ttgtccattttaaaaagactcccaaggattttcgacagaagccatgaatacaaacattgg
ccaggattaatcaaagcatataaaaaatggcttccagtcactgataaaactcctataatc
acgcttcaagagggagcaactccattaatacctttgaaatcaattaatgaattaattggt
aaaaatgtcaagatttttgtcaagtatgacggtttaaacccaactggatcttttaaagat
agagggatgacaatggcaataagtaaagctaaagaagataattgtgaagcagtgatttgc
gctagcactggaaacacatctgcttctgcagcagcttatgcaaaaagaggaggaatgaaa
agttttgttttgatcccagatgggtatgtagcacaaggaaagcttgctcaagcacttgtt
tatggtgctgaagttttagcaattaaaggaaactttgataaagcattaaatattgtccaa
gagttatcaaatagatacccaataactttagtaaattccgttaatccttatcgtattcaa
gggcaaaaaactgcagcttttgaaattatagactcaattggtgaagcaccagactggtta
tgtattccaatgggaaatgcaggaaatattacagcatattggatggggtttgaagaatat
tataaagctgggaaaagtaaaaagttacctaaaatgatgggttttcaagctattggctct
gcacctttagtttttaataaaacaattgaaaatccagaaacaatagcaacagcaataaga
atcggaaaccctgttaataaagaaaaagcatttattgtaaaaggtaaaagtaaaggtaaa
tttactgctgttactgataaagaaattatagatgcttataaacttttaggtaaagaagaa
ggtattttttgtgaaccagcaagtgcagcatctatagctggattaataaaattgaaagaa
gaaattcctccaaattctacaattgtttgtgttttaacaggtaatggtttaaaagatcct
gattgtgcaattaataataatgatgcatcttttaaaaataatttagaacctaattctgat
gaaatagcaaaagccataggattctaa

DBGET integrated database retrieval system