KEGG   Prochlorococcus marinus MIT 9211: P9211_18541Help
Entry
P9211_18541       CDS       T00616                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pmj  Prochlorococcus marinus MIT 9211
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pmj01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pmj00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:pmj00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
1687695..1688801
Genome map
AA seq 368 aa AA seqDB search
MSILKRLPRIFDRSHEYKHWPGLIKAYKKWLPVTDKTPIITLQEGATPLIPLKSINELIG
KNVKIFVKYDGLNPTGSFKDRGMTMAISKAKEDNCEAVICASTGNTSASAAAYAKRGGMK
SFVLIPDGYVAQGKLAQALVYGAEVLAIKGNFDKALNIVQELSNRYPITLVNSVNPYRIQ
GQKTAAFEIIDSIGEAPDWLCIPMGNAGNITAYWMGFEEYYKAGKSKKLPKMMGFQAIGS
APLVFNKTIENPETIATAIRIGNPVNKEKAFIVKGKSKGKFTAVTDKEIIDAYKLLGKEE
GIFCEPASAASIAGLIKLKEEIPPNSTIVCVLTGNGLKDPDCAINNNDASFKNNLEPNSD
EIAKAIGF
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
ttgtccattttaaaaagactcccaaggattttcgacagaagccatgaatacaaacattgg
ccaggattaatcaaagcatataaaaaatggcttccagtcactgataaaactcctataatc
acgcttcaagagggagcaactccattaatacctttgaaatcaattaatgaattaattggt
aaaaatgtcaagatttttgtcaagtatgacggtttaaacccaactggatcttttaaagat
agagggatgacaatggcaataagtaaagctaaagaagataattgtgaagcagtgatttgc
gctagcactggaaacacatctgcttctgcagcagcttatgcaaaaagaggaggaatgaaa
agttttgttttgatcccagatgggtatgtagcacaaggaaagcttgctcaagcacttgtt
tatggtgctgaagttttagcaattaaaggaaactttgataaagcattaaatattgtccaa
gagttatcaaatagatacccaataactttagtaaattccgttaatccttatcgtattcaa
gggcaaaaaactgcagcttttgaaattatagactcaattggtgaagcaccagactggtta
tgtattccaatgggaaatgcaggaaatattacagcatattggatggggtttgaagaatat
tataaagctgggaaaagtaaaaagttacctaaaatgatgggttttcaagctattggctct
gcacctttagtttttaataaaacaattgaaaatccagaaacaatagcaacagcaataaga
atcggaaaccctgttaataaagaaaaagcatttattgtaaaaggtaaaagtaaaggtaaa
tttactgctgttactgataaagaaattatagatgcttataaacttttaggtaaagaagaa
ggtattttttgtgaaccagcaagtgcagcatctatagctggattaataaaattgaaagaa
gaaattcctccaaattctacaattgtttgtgttttaacaggtaatggtttaaaagatcct
gattgtgcaattaataataatgatgcatcttttaaaaataatttagaacctaattctgat
gaaatagcaaaagccataggattctaa

DBGET integrated database retrieval system