KEGG   Pseudomonas mendocina NK-01: MDS_0112Help
Entry
MDS_0112          CDS       T01473                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pmk00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
124650..125552
Genome map
AA seq 300 aa AA seqDB search
MSTAQVERVELDQLTCWRIRVAGSVLLVAQQGAQILSYQQGEQPPLIWLSPDAAYRTGQS
VRGGVPVCWPWFGDLRRNPPPVQAHYHLEQAPAHGLVRALDWELLGIDEEDGAVTLRFAY
DTRNQPLEGWPRDVGLTFVVRVAQDLGMSLETHNRGTEPLTLSQALHSYFAVSDVRQVSV
EGLQGCRYIDTLQDWRELRQQDALVFDAETDRIYFDTAARLSIIDPGWGRRIHLDARGSR
SAVLWNPWIDKASRLSQFPDDAWQSMLCIETANVLEDIVQLKADERHRLELRLSSEPLAS
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgcccaagtcgaacgcgtggaactggatcaactgacctgctggcgaatccgc
gtcgcgggcagcgtgctgctggtcgctcagcagggcgcgcagattctcagttaccagcag
ggcgaacagccgccgctgatctggctgagcccggacgctgcctatcggaccggacaaagc
gtgcgcggtggtgtgccggtgtgctggccctggttcggcgatctgcggcgcaatccgccg
cccgtgcaggcgcactatcaccttgagcaggcaccagcccatggcctggtgcgcgcgctg
gactgggagctgctgggcatcgacgaagaggatggcgccgttaccctgcgcttcgcctac
gacacccgcaaccagccgctggagggttggcctcgggatgtcggtctgacctttgtcgtg
cgtgtggcgcaggacctcggcatgagcctggagacccacaatcgcggtacggagccgctg
accctgagccaggcactgcacagctacttcgctgtcagcgacgtgcgccaggtcagcgtc
gaggggctgcagggctgtcgctatatcgacaccctgcaggattggcgggagctgcgtcag
caggatgccctggtgttcgatgcggagaccgatcgcatctatttcgacaccgccgcgcgg
ctgagcatcatcgatcccggatggggccggcgcatccatctggatgctcgcggttcgcgc
tcggccgtgctgtggaatccctggatcgacaaggccagtcgcctgtcgcagttccccgac
gacgcctggcagagcatgctttgcatcgagacggccaacgtgctggaagacatcgtgcag
ctgaaggccgacgagcgccatcggcttgagttgcgcctgtccagtgagccgctcgctagt
tag

DBGET integrated database retrieval system