KEGG   Pseudomonas mendocina NK-01: MDS_0117Help
Entry
MDS_0117          CDS       T01473                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MDS_0117
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MDS_0117
  Lipid metabolism
   00071 Fatty acid degradation
    MDS_0117
  Amino acid metabolism
   00350 Tyrosine metabolism
    MDS_0117
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MDS_0117
   00626 Naphthalene degradation
    MDS_0117
Enzymes [BR:pmk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MDS_0117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
128982..130004
Genome map
AA seq 340 aa AA seqDB search
MNQTMKAAVVHAFGQPLRIEEVKTPLPGPGQILVKIEASGVCHTDLHAAEGDWPVKPSLP
FIPGHEGVGYVAAVGSGVTRVKEGDRVGVPWLYTACGCCEHCLTGWETLCESQQNTGYSI
NGGYAEYVLADPNYVGILPKSVDFLEIAPILCAGVTVYKGLKETKARPGQWVAISGIGGL
GHVAVQYARAMGLHVVAVDVDDAKLELARKLGASLTINARKENPAEVVQRDIGGAHGVLV
TAVSNTAFGQAIGMARRHGTVALVGLPPGDFPTPIFDVVLKAISITGSIVGTRADLQEAL
DFAGEGLVKATVRSDSLDNINGIFDQMRGGQIEGRVVLQF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagaccatgaaagccgcagtcgtccacgccttcgggcagccgctgcgtatcgag
gaggtgaaaaccccgctacccggccctgggcagattctggtgaagatcgaagcgtcgggt
gtatgtcacaccgacctgcacgcagccgaaggcgactggccggtgaagccgagtctgccg
ttcattcccggtcacgagggcgtcggctacgtggcggcggtcggcagtggcgtgacgcgg
gtaaaggaaggcgaccgtgtcggcgtgccctggctctacaccgcctgtggctgctgcgaa
cactgcctgaccggctgggaaaccctctgcgagagtcagcagaataccggctattcgatc
aacggcggttacgccgaatacgtgctggctgatccgaactacgtcggcatcctgccgaaa
agcgtcgatttccttgaaattgcgccgatcctttgcgcaggcgtgacggtgtacaagggc
ctcaaggaaaccaaggcccgccccggacagtgggtagcgatctccggtattggcggtctc
ggccacgtggccgtgcagtacgcccgcgccatgggcctgcacgtggtcgcggtggatgtc
gacgatgccaagctggagctggcgcgcaagctcggcgccagcctgaccatcaacgcgcgc
aaggaaaatccggccgaggtggtgcaacgcgatatcggcggtgcccacggcgtgctggtc
accgcggtgtccaacacggccttcggccaggccatcggcatggcgcgccggcacggtacg
gtggcgctggttggcttgccgccgggtgacttccccacgccgatcttcgacgtggtgctc
aaggccatcagcatcaccggctccatcgtcggcacccgcgccgatctgcaggaggcgctg
gactttgccggcgaagggttggtcaaggccacggtacgcagcgacagcctggacaacatc
aacggtatcttcgaccagatgcgcggcgggcagatcgaggggcgggtggtactgcagttc
taa

DBGET integrated database retrieval system