KEGG   Pseudomonas mendocina NK-01: MDS_0155Help
Entry
MDS_0155          CDS       T01473                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pmk00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pmk00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:pmk00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(167132..168040)
Genome map
AA seq 302 aa AA seqDB search
MQALLNEILDEVRPLIGQGKVADYIPALASVVPDQLGIAVYGNDGQLHVAGDAHMPFSIQ
SISKVFSLVQAIGHSGESIWQRLGHEPSGQPFNSLVQLEFERGKPRNPFINAGALVICDI
NQSRYAAPALSMRDFVRRLSGNPEVTVDNHVAESEYQHRARNAAAAYLMQSFGNFHNEVE
AVLRSYFSCCALRMSCVDLARAFGFLANQGFCKHSGEQVLSPRQSKQINAIMATSGLYDE
AGNFAYRVGLPGKSGVGGGIVAVVPGRFSVCVWSPELNAAGNSLAGMKALELLSQRIGWS
VF
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgctgttgaacgaaattctcgatgaagtccgcccgctgatcggccagggcaag
gtggccgattacatcccggctctggccagtgtggtgcccgatcaactaggaatcgccgtg
tatggcaacgacggccagctgcatgtcgccggcgatgcgcacatgccgttttccatccag
agcatttccaaggtgttcagcctggtgcaggccatcggccacagcggcgaaagcatctgg
caacgcctgggccacgagccgtccgggcagccgttcaactcactggtacagctggagttc
gagcgtggcaagccgcgcaatccgttcatcaatgccggcgcgctggtgatctgcgatatc
aaccagtcgcgctacgccgcgccggcgctgtcgatgcgggacttcgtccggcgcctgtcg
ggcaaccccgaggtgacggtggacaaccatgtcgccgaatccgagtaccagcaccgcgcg
cgcaacgccgcagcggcgtacctgatgcagtcgttcggcaacttccacaacgaggtcgag
gccgtgctgcgtagctatttcagctgctgcgcgctgcgcatgagctgcgtcgatctggcg
cgcgccttcggcttcctggccaaccagggcttctgcaaacacagcggcgagcaggtgctg
tcgccccgccagagcaagcagatcaacgccatcatggccaccagcgggctgtacgacgaa
gccggcaacttcgcctatcgcgtcggcctgccgggcaagagcggtgtcggcggcggtatc
gtcgcggtggtgcccgggcgtttcagcgtctgcgtatggtcgcccgagctcaacgccgcc
ggcaattcgctggccggcatgaaggcgctggagctgctcagccagcgcatcggttggtcg
gttttctga

DBGET integrated database retrieval system