KEGG   Pseudomonas mendocina NK-01: MDS_0176Help
Entry
MDS_0176          CDS       T01473                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
pmk  Pseudomonas mendocina NK-01
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
187273..189129
Genome map
AA seq 618 aa AA seqDB search
MSDDARRWKDKYLSSLEQQEKLERRWESRLDLLRRGLVRSSLAAEGTDKAVDQCMQEMRE
ILRRDDIDAALGGLIPRLEKAVLDSEQRRQQRAGEAATALAGLIEQLQRLQPPREVRKAL
KSLGKQLQDATSHQYLLPALLSQLSNLQGQALTVLQAPVQEQPGLLQRLFGSRGESSEET
AKAGPAPAPAPAPAPISEPEVEPATVSESAERTPEVLMPASEPAAVASLAKRKHQANDAA
PMLDSLPLPPGLVSPEDAGDSPFSLPSSEPGYSAVAPHIASSLRSLLDELELPARHQPQG
DALRQRLEGNLNWYELVPVLDDLAVLVLAVTDSGQREFAGYLKQLNERLAAFISTLSEAH
EGYTASVESTRHFNQQLRDQVSDLQNSVQEAADLDALKQALEQRLEGLLQSVSNHQRQRD
SGEDDVAERLQGLVKRVAEMELEAQQFRQHIEEQRQKSLLDPLTGLPNRAAWSERLDLEI
ARRQRYGGQLLMAVLDIDHFKRINDGYGHLAGDRVLKIIAGELHKRLRKTDFIARFGGEE
FVLLIPGTPLDGGVQLLETLRAAVEACPFHFKGEPVTITLSAGIAEFRNDEATEDTFERA
DQALYRAKGAGRNRVEQA
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgacgcgcgacgttggaaagacaaatacctgagcagcctggaacaacaggaa
aagcttgaacgccgttgggagtcacgcctggatctgctgcgccgtggcctggtgcgcagc
agtctggctgccgagggcacggacaaggcggtcgatcagtgcatgcaggagatgcgcgag
attctccgccgcgacgacatcgacgctgcgctgggtggcctgattccacgcctggaaaag
gctgtgctggattccgagcagcgccgtcagcagcgcgccggcgaggccgccacggcattg
gcgggcctgatcgaacagctgcaacgtctgcagccgccgcgtgaggtacgcaaggcactc
aagtcactcggcaagcaactgcaggacgccaccagccaccagtatctgttgcccgcattg
ctcagccaactgagcaacctgcaagggcaggcgctgaccgttctgcaagccccggtgcag
gagcaacccggcttgctgcagcgcctcttcggctcgcggggtgaaagtagcgaagagacc
gccaaagctggtcctgcacctgcacctgcacctgcacctgcacctatatctgagcctgag
gttgagcctgccactgtctccgagagtgcagagcgcacgccagaggtcctcatgcctgcg
agcgagccagcggctgttgccagcttggcaaagagaaagcatcaggccaacgacgccgcg
cccatgctcgacagcctgccactgccgcctggcctggtgtcgccggaggatgcaggcgac
agcccgttctccctgcccagcagcgaacccggatacagcgcggtggccccgcatatcgcc
agcagcttgcgcagcctgctcgacgagctggagttgccggcacgtcatcagccgcaaggc
gatgcgctgcgccagcgtctggagggcaacctcaactggtacgaactggtacccgtgctg
gacgatctggctgtgctggtattggcagtcaccgacagtggccagcgtgagttcgccggt
tatctcaagcagctcaacgagcgcctggccgcctttatcagcaccctcagtgaagcgcat
gagggttataccgcctcggtggaaagcacgcgccacttcaaccagcagttgcgcgatcag
gtcagcgacttgcagaacagcgtgcaggaggcggccgatctggacgcgctcaagcaggcg
ctggagcagcgtctggagggcctgctgcagagcgtcagcaatcatcagcgtcagcgcgac
agtggtgaggatgacgtggcggaacggctgcagggcctggtcaagcgtgtcgctgaaatg
gagctcgaggcgcagcagtttcgccaacatatcgaggagcagcggcagaaatcgctgctc
gaccctctgaccggcttgcccaatcgcgcggcctggagcgagcgcctcgacctggagatt
gcccgacgccagcgctatggcggccagttgctgatggcggtgctggatatcgaccacttc
aagcggatcaacgatggctacggtcacctggcaggggatcgagtgctgaagatcattgcc
ggtgaactgcacaaacgtctgcgcaagaccgatttcattgcccgcttcggtggcgaggag
ttcgttctgctgattccaggcacgccgcttgatggaggcgtgcaattgctggaaaccctg
cgtgcagcggtcgaagcctgcccgttccacttcaagggcgagccagtgaccatcactctt
tccgccggcattgcagagtttcgcaatgacgaggccaccgaggataccttcgagcgcgcc
gatcaggcgctatatcgagccaagggtgctgggcgcaaccgcgttgaacaggcctga

DBGET integrated database retrieval system