KEGG   Pseudomonas mendocina NK-01: MDS_0176Help
Entry
MDS_0176          CDS       T01473                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
pmk  Pseudomonas mendocina NK-01
Brite
Enzymes [BR:pmk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     MDS_0176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
187273..189129
Genome map
AA seq 618 aa AA seqDB search
MSDDARRWKDKYLSSLEQQEKLERRWESRLDLLRRGLVRSSLAAEGTDKAVDQCMQEMRE
ILRRDDIDAALGGLIPRLEKAVLDSEQRRQQRAGEAATALAGLIEQLQRLQPPREVRKAL
KSLGKQLQDATSHQYLLPALLSQLSNLQGQALTVLQAPVQEQPGLLQRLFGSRGESSEET
AKAGPAPAPAPAPAPISEPEVEPATVSESAERTPEVLMPASEPAAVASLAKRKHQANDAA
PMLDSLPLPPGLVSPEDAGDSPFSLPSSEPGYSAVAPHIASSLRSLLDELELPARHQPQG
DALRQRLEGNLNWYELVPVLDDLAVLVLAVTDSGQREFAGYLKQLNERLAAFISTLSEAH
EGYTASVESTRHFNQQLRDQVSDLQNSVQEAADLDALKQALEQRLEGLLQSVSNHQRQRD
SGEDDVAERLQGLVKRVAEMELEAQQFRQHIEEQRQKSLLDPLTGLPNRAAWSERLDLEI
ARRQRYGGQLLMAVLDIDHFKRINDGYGHLAGDRVLKIIAGELHKRLRKTDFIARFGGEE
FVLLIPGTPLDGGVQLLETLRAAVEACPFHFKGEPVTITLSAGIAEFRNDEATEDTFERA
DQALYRAKGAGRNRVEQA
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgacgcgcgacgttggaaagacaaatacctgagcagcctggaacaacaggaa
aagcttgaacgccgttgggagtcacgcctggatctgctgcgccgtggcctggtgcgcagc
agtctggctgccgagggcacggacaaggcggtcgatcagtgcatgcaggagatgcgcgag
attctccgccgcgacgacatcgacgctgcgctgggtggcctgattccacgcctggaaaag
gctgtgctggattccgagcagcgccgtcagcagcgcgccggcgaggccgccacggcattg
gcgggcctgatcgaacagctgcaacgtctgcagccgccgcgtgaggtacgcaaggcactc
aagtcactcggcaagcaactgcaggacgccaccagccaccagtatctgttgcccgcattg
ctcagccaactgagcaacctgcaagggcaggcgctgaccgttctgcaagccccggtgcag
gagcaacccggcttgctgcagcgcctcttcggctcgcggggtgaaagtagcgaagagacc
gccaaagctggtcctgcacctgcacctgcacctgcacctgcacctatatctgagcctgag
gttgagcctgccactgtctccgagagtgcagagcgcacgccagaggtcctcatgcctgcg
agcgagccagcggctgttgccagcttggcaaagagaaagcatcaggccaacgacgccgcg
cccatgctcgacagcctgccactgccgcctggcctggtgtcgccggaggatgcaggcgac
agcccgttctccctgcccagcagcgaacccggatacagcgcggtggccccgcatatcgcc
agcagcttgcgcagcctgctcgacgagctggagttgccggcacgtcatcagccgcaaggc
gatgcgctgcgccagcgtctggagggcaacctcaactggtacgaactggtacccgtgctg
gacgatctggctgtgctggtattggcagtcaccgacagtggccagcgtgagttcgccggt
tatctcaagcagctcaacgagcgcctggccgcctttatcagcaccctcagtgaagcgcat
gagggttataccgcctcggtggaaagcacgcgccacttcaaccagcagttgcgcgatcag
gtcagcgacttgcagaacagcgtgcaggaggcggccgatctggacgcgctcaagcaggcg
ctggagcagcgtctggagggcctgctgcagagcgtcagcaatcatcagcgtcagcgcgac
agtggtgaggatgacgtggcggaacggctgcagggcctggtcaagcgtgtcgctgaaatg
gagctcgaggcgcagcagtttcgccaacatatcgaggagcagcggcagaaatcgctgctc
gaccctctgaccggcttgcccaatcgcgcggcctggagcgagcgcctcgacctggagatt
gcccgacgccagcgctatggcggccagttgctgatggcggtgctggatatcgaccacttc
aagcggatcaacgatggctacggtcacctggcaggggatcgagtgctgaagatcattgcc
ggtgaactgcacaaacgtctgcgcaagaccgatttcattgcccgcttcggtggcgaggag
ttcgttctgctgattccaggcacgccgcttgatggaggcgtgcaattgctggaaaccctg
cgtgcagcggtcgaagcctgcccgttccacttcaagggcgagccagtgaccatcactctt
tccgccggcattgcagagtttcgcaatgacgaggccaccgaggataccttcgagcgcgcc
gatcaggcgctatatcgagccaagggtgctgggcgcaaccgcgttgaacaggcctga

DBGET integrated database retrieval system