KEGG   Pseudomonas mendocina NK-01: MDS_0184Help
Entry
MDS_0184          CDS       T01473                                 

Definition
CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pmk02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:pmk02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
197839..198450
Genome map
AA seq 203 aa AA seqDB search
MSSQRISLRGQVRAPLQALLIGASAGGVEALLSLLEDLPPDYRLPVVCLLHQPDRNDSLL
ADLLARRLKLPTKEAEDKEYLRSGMVYVAPAGYHLSIETERSFSLSREEPRHFSRPSIDI
LFESAADAYGEHLAAALLTGANEDGAVGLLAVQQAGGLTLVQDPADALVPTMPNAALALL
KPDFLLPINAMRLLLAELDTLPC
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccagcggatcagcctccgcggccaggttcgtgcgccgctgcaggcgctgctg
atcggtgcttctgcgggcggcgtggaagccttgctcagcctgctcgaagacctgccgccg
gactaccggctaccggtggtgtgtctgctgcatcagccggatcgcaacgacagcctgctt
gccgatctgctcgcgcggcgtctgaagctgccgaccaaggaagccgaggacaaggaatac
ctgcgcagcggcatggtttacgtggcgcccgcgggttaccacctgtccatcgaaaccgag
cgcagcttttccctcagtcgtgaggagccgcggcatttctcccggccctcgatcgacatc
ctcttcgagtctgctgccgatgcctacggcgagcacctggctgctgcgctgctgactggc
gccaacgaggatggcgctgtcggcctgctggctgttcagcaggccggtgggctgacactg
gtacaggacccggccgacgcgctggtgcccaccatgccgaatgccgcgctggcgctgctc
aaaccggattttctcctgcctatcaatgccatgcgcctgctgctggccgaactggatacc
ctgccatgctga

DBGET integrated database retrieval system