KEGG   Pseudomonas mendocina NK-01: MDS_0184Help
Entry
MDS_0184          CDS       T01473                                 

Definition
(GenBank) CheB methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk02020  Two-component system
pmk02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MDS_0184
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    MDS_0184
Enzymes [BR:pmk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     MDS_0184
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     MDS_0184
Two-component system [BR:pmk02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   MDS_0184
Bacterial motility proteins [BR:pmk02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    MDS_0184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest
Motif
Other DBs
NCBI-ProteinID: AEB56215
UniProt: F4DWX3
Position
197839..198450
Genome map
AA seq 203 aa AA seqDB search
MSSQRISLRGQVRAPLQALLIGASAGGVEALLSLLEDLPPDYRLPVVCLLHQPDRNDSLL
ADLLARRLKLPTKEAEDKEYLRSGMVYVAPAGYHLSIETERSFSLSREEPRHFSRPSIDI
LFESAADAYGEHLAAALLTGANEDGAVGLLAVQQAGGLTLVQDPADALVPTMPNAALALL
KPDFLLPINAMRLLLAELDTLPC
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccagcggatcagcctccgcggccaggttcgtgcgccgctgcaggcgctgctg
atcggtgcttctgcgggcggcgtggaagccttgctcagcctgctcgaagacctgccgccg
gactaccggctaccggtggtgtgtctgctgcatcagccggatcgcaacgacagcctgctt
gccgatctgctcgcgcggcgtctgaagctgccgaccaaggaagccgaggacaaggaatac
ctgcgcagcggcatggtttacgtggcgcccgcgggttaccacctgtccatcgaaaccgag
cgcagcttttccctcagtcgtgaggagccgcggcatttctcccggccctcgatcgacatc
ctcttcgagtctgctgccgatgcctacggcgagcacctggctgctgcgctgctgactggc
gccaacgaggatggcgctgtcggcctgctggctgttcagcaggccggtgggctgacactg
gtacaggacccggccgacgcgctggtgcccaccatgccgaatgccgcgctggcgctgctc
aaaccggattttctcctgcctatcaatgccatgcgcctgctgctggccgaactggatacc
ctgccatgctga

DBGET integrated database retrieval system