KEGG   Pseudomonas mendocina NK-01: MDS_0213Help
Entry
MDS_0213          CDS       T01473                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MDS_0213
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MDS_0213
   00630 Glyoxylate and dicarboxylate metabolism
    MDS_0213
Enzymes [BR:pmk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MDS_0213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(226760..228937)
Genome map
AA seq 725 aa AA seqDB search
MTERVQCQRLQVAAELKQFIESEVLPGSGVEANAFWSGFDALVHDLAPRNRALLAERDRL
QSELDSWHRANPGPITDMNAYRAFLGSIGYLLPQPEQVKATTANVDSEIATQAGPQLVVP
VMNARYALNAANARWGSLYDALYGTDAISEEGGASKGPGYNEVRGAKVIAFARSFLDQAA
PLAQGSHADASAYAVVAGQLQVTLSSGAQTSLAQPEKFVGFQGEAATPSAVLLKNNGLHF
EIQIDAGSPIGRTDAAGVKDVLMEAALSTIMDCEDSVAAVDAADKVVVYRNWLGLMKGDL
AEELEKGGKRITRRLNADRVYTAADGSELTLHGRSLLFIRNVGHLMSNPAIIDGEGLEIP
EGILDAVVTSLIALHDLKRRGNSRTGSVYIVKPKMHGPFEVAFANELFGRVEQLLGMPAN
TLKMGIMDEERRTSVNLKACIEAASARVAFINTGFLDRTGDEMHTAMEAGAMLRKGDMKS
SAWIQAYERNNVLVGLACGLRGKAQIGKGMWAMPDLMAAMLEQKIGHPKAGANTAWVPSP
TAAVLHALHYHQIDVQAVQSELELIDLASQRDSLFNDLLSVPVSAERPWSASDIQQELDN
NCQGILGYVVRWVEQGVGCSKVPDIHNVGLMEDRATLRISAQHIANWLHHGVVNEAQVRE
TLQRMAQVVDGQNAGDPAYRPMAPNFEQSHAFRAASDLVFKGREQPSGYTEPLLHAWRLR
FKEEV
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacgcgtgcaatgtcagcgcctgcaagtggccgccgagctcaagcaattcatc
gaaagcgaggtgctgcccggcagcggtgtcgaagccaatgccttctggagcggtttcgat
gcgctggtgcacgacctggcgccacgcaatcgtgcgttgctggccgagcgtgaccgcctg
cagagcgagctggatagctggcaccgcgccaaccccgggccgatcactgacatgaacgcc
taccgcgccttcctcggctccatcggctatctgctgccgcagccggagcaggtcaaggcg
accaccgccaatgtcgacagcgagatcgccacccaggccggcccacagctggtcgtgccg
gtgatgaatgcgcgctatgcgctgaacgccgccaacgcccgttggggctcgttgtacgac
gccctatacggcaccgatgccatcagcgaagagggtggtgccagcaaaggcccgggctat
aacgaagtgcgcggcgccaaggtgatcgccttcgcccgctcattcctcgaccaggccgcc
ccactggcccagggctcgcacgcagatgccagtgcctatgccgtggtcgcaggccaactg
caggtaaccctgagcagcggcgcgcagacttcgctggcgcaaccggagaagttcgtcggt
ttccagggcgaggctgccacgccgagcgccgtgctgctgaagaacaacggcctgcacttc
gagatccagatcgacgcaggtagccccatcggccgtaccgacgccgccggcgtgaaggac
gtgctgatggaggcggcgctgtcgaccatcatggactgcgaggactccgtggccgccgtc
gacgccgccgacaaggtggtggtctaccgcaactggctgggcctgatgaagggtgacctg
gccgaggagctggaaaagggtggcaagcgcatcacccgccgcctcaatgcggatcgcgtc
tacaccgccgccgatggcagcgaactgaccctgcacggtcggtcattgctgttcatccgc
aacgtcggccacctgatgagcaacccggcgatcatcgacggtgaaggcttggaaattccc
gagggcatcctcgatgcggtggtcaccagcctgatcgccctgcatgacctcaagcgccgc
ggtaactcgcgcaccggcagcgtctatatcgtcaaaccgaagatgcacgggccgttcgaa
gtggccttcgccaacgaactgttcggtcgcgtcgagcaactactgggcatgccagccaat
accctgaaaatgggcatcatggacgaggagcggcgcaccagcgtcaacctcaaggcctgc
atcgaggccgccagcgcgcgcgtggccttcatcaacactggcttcctcgaccgcaccggc
gacgaaatgcacaccgccatggaagccggcgccatgctgcgcaagggcgacatgaaatcc
agcgcctggatccaggcctacgagcgtaacaatgtactggtcggcctggcctgcggcctg
cgcggcaaggcgcagatcggcaagggcatgtgggccatgccggatctgatggccgccatg
ctcgaacagaagatcggccacccgaaagccggcgccaacaccgcctgggtgccgtcgccg
accgcagccgtgctgcacgccctgcactatcaccagatcgacgtgcaggcggtgcagagc
gagctggagctgatcgacctggccagccagcgcgacagcctgttcaacgacctgctcagc
gtgccggtcagcgccgagcggccgtggagcgccagcgatatccagcaggaactggacaac
aactgccagggcatcctcggttacgtggtgcgctgggtcgagcagggcgtcggctgctcc
aaggtgccggatatccacaacgtcggcctgatggaagaccgcgccaccctacgcatttcg
gcccaacacatcgccaactggctgcaccacggtgtggtcaacgaggcccaggtgcgcgag
acgctgcaacgcatggcacaggtggtcgacgggcagaatgccggcgatcctgcctaccgc
ccgatggcgccgaacttcgagcaatcccacgccttccgcgccgccagtgacctggtgttc
aagggccgcgagcagccgtccggctataccgagccgctgctgcatgcctggcggttgcgc
ttcaaagaggaggtttga

DBGET integrated database retrieval system