KEGG   Pseudomonas mendocina NK-01: MDS_0286Help
Entry
MDS_0286          CDS       T01473                                 

Definition
4-aminobutyrate aminotransferase
Orthology
K14268  
5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    MDS_0286
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MDS_0286
   00310 Lysine degradation
    MDS_0286
Enzymes [BR:pmk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     MDS_0286
    2.6.1.48  5-aminovalerate transaminase
     MDS_0286
Amino acid related enzymes [BR:pmk01007]
 Aminotransferase (transaminase)
  Class III
   MDS_0286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
303684..304964
Genome map
AA seq 426 aa AA seqDB search
MSKTNESLLQRRAAAVPRGVGQIHPIVAERAENATVWDVEGREYIDFAGGIAVLNTGHLH
PKVIAAVQEQLTKLTHTCFQVLAYEPYIELCEEIAKRVPGDFAKKTLLVTSGSEAVENAV
KIARAATGRAGVIAFTGAYHGRTMMTLSLTGKVVPYSAGMGLMPAGVYRAQAPCPLHGVS
EDESIASIERIFKNDAQPQDIAAIIIEPVQGEGGFYVNSPAFMQRLRALCDQHGILLIAD
EVQTGAGRTGTFFATEQLGVVPDLTTFAKSVGGGFPISGVCGKAEIMDKIAPGGLGGTYA
GSPIACAAALAVLKVFDEEKLLARSNAVGEKLKAGLSKIAEKHKVIGDVRGLGSMVAIEL
FEGGDVHKPAAELVGKIVAKARDKGLILLSCGTYYNVIRFLMPVTIPDAQLEKGIAIVAE
CFDELA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaccaacgaatccctgctgcaacgccgtgctgccgccgtaccgcgcggtgtc
ggccagatccacccgatcgtcgccgagcgcgccgagaacgccaccgtgtgggacgtcgaa
ggccgcgagtacatcgacttcgccggtggtatcgccgtactgaacaccggccacctgcat
cccaaggtgatcgctgccgttcaggagcaactgaccaagctgacccacacctgcttccag
gtgctggcctacgaaccctacatcgagctgtgcgaagagatcgccaagcgcgtgccgggt
gacttcgccaagaagaccctgctggtcacctccggctccgaagccgtcgagaacgccgtg
aagatcgcccgtgccgccaccggccgcgccggcgtgatcgcctttaccggcgcctaccac
ggccgcaccatgatgaccctgtcgctgaccggcaaggtggtgccgtactccgccggcatg
ggcctgatgccggctggcgtgtaccgtgcccaggcgccgtgcccgctgcatggcgtgagc
gaggacgagtccatcgccagcatcgagcgcatcttcaagaacgacgcgcagccgcaggac
atcgctgcgatcatcatcgagccggtgcagggcgaaggcggtttctacgtcaactcgccg
gccttcatgcaacgcctgcgcgccctgtgcgaccagcacggcatcctcctgatcgctgac
gaagtgcagaccggcgctggccgtaccggcaccttcttcgccaccgagcaactgggcgtg
gtgccggatctgaccaccttcgccaagtccgtcggcggcggcttcccgatctccggcgtg
tgcggcaaggccgagatcatggacaagatcgcccccggtggcctgggcggcacctacgcc
ggcagcccgatcgcctgcgctgcggccctggccgtactcaaggtgttcgacgaagagaaa
ctgctggcgcgttccaacgccgtcggtgagaagctcaaagccggcctgagcaagatcgcc
gagaagcacaaggtcatcggtgacgtgcgcggcctgggttcgatggtcgccatcgagctg
ttcgagggcggtgacgtgcacaagccggctgccgaactggtcggcaagatcgtcgccaag
gcgcgcgacaagggcctgatcctgctgtcgtgcggcacctactacaacgtcatccgcttc
ctgatgcccgtcaccattccggacgcgcaactggaaaaaggtatcgccatcgtcgcagag
tgcttcgacgaactggcctga

DBGET integrated database retrieval system