KEGG   Pseudomonas mendocina NK-01: MDS_0341Help
Entry
MDS_0341          CDS       T01473                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pmk00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
358925..359695
Genome map
AA seq 256 aa AA seqDB search
MSAWRLLLTRPAEDCAVLAQTLAAQGVASHCMPLLAIEALAETAEQRGTFAELQRYCAVI
VVSKPAARIALQLLARHAVPTPDLPWFSVGAATAAVLAEQGLRVHFPDSGDDSEALLALP
ALHQAIATTAAPRVLILRGEGGREFLAERLRGQGVTVDYLPLYRRVLPQYAPGELGQCVR
AERLNGLVVSSGQGFEHLLQLAGDDWPALARLPLFVPSPRVAEQARKAGAEIVVDCRGAS
AAALQAALEQFPAAAL
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgcctggcgcctgttgctgacgcgtcctgccgaggactgtgcggtgctggcgcag
accctggccgctcagggcgtcgccagtcactgcatgccgctgctggccatcgaggcgttg
gccgaaaccgctgagcagcgcggcactttcgccgagcttcagcgctattgtgcggtgatc
gtggtcagcaagccggccgccaggattgctctgcagctattggcgcgccatgcggtaccg
acacctgatttgccctggttcagtgtcggagccgctaccgccgcagtgctcgccgagcag
ggcttgcgtgtgcattttcccgactctggcgatgacagcgaagcgctgctcgcgctacct
gctctgcaccaggctatcgccacgacagcggctccacgcgtcttgattctgcgtggcgaa
ggtggccgagaattcctcgccgaacgcttgcgcggccaaggcgtgacggtcgactatctg
ccactgtatcgccgtgtgctgccgcagtacgcgccgggtgagctcggccagtgcgtgcga
gcggaacgcctgaacggcctggttgtcagcagtggacagggtttcgaacacctgctgcaa
ctggctggcgatgactggccagcgttggctcggctacccttgttcgtacccagcccgcgc
gttgccgagcaggcgcgcaaagcgggtgcggaaatcgttgtggactgtcgcggcgccagc
gccgcggccttgcaggcagcgctggagcagtttccggctgccgccctctaa

DBGET integrated database retrieval system