KEGG   Pseudomonas mendocina NK-01: MDS_0359Help
Entry
MDS_0359          CDS       T01473                                 

Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk00860  Porphyrin and chlorophyll metabolism
pmk01100  Metabolic pathways
pmk01110  Biosynthesis of secondary metabolites
pmk01120  Microbial metabolism in diverse environments
Module
pmk_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MDS_0359
Enzymes [BR:pmk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     MDS_0359
Exosome [BR:pmk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MDS_0359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: AEB56390
UniProt: F4DYS3
Position
375516..376529
Genome map
AA seq 337 aa AA seqDB search
MSVTPANRLFPATRLRRNRRDDFSRRLVREHRLSVDDLILPVFVLDGENRREAVPSMPGV
ERLSIDLLLQEAEHWVELGIPALALFPVTPLEKKSLDGAEAWNPDGIAQRAIRALRAKFP
ELGVISDVALDPFTTHGQDGILDESGYVQNDITVDALVKQALSHAEAGAQVVAPSDMMDG
RVQAIREALELAEHVNVRIMAYSAKYASAYYGPFRDAVGSAANLGKGNKLGYQMDPANGN
EALHEVAADLAEGADMVMVKPGMPYLDILWRVKDAYKVPTFVYQVSGEYAMHMAAIQNGW
LSEAVILESLTAFKRAGADGILTYFAVRAAELLKQGR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgttacccccgccaatcgtctgttccctgccacccgtctgcgtcgcaaccgtcgt
gacgacttttcccgtcgcctggtgcgcgagcatcgcctgagcgtcgatgacctgatcctg
ccggtgttcgtcctcgacggcgaaaaccgccgcgaagccgtgccgtcgatgccgggtgtc
gagcgtctgtccatcgacctgctgctgcaggaggccgagcactgggtcgagctgggcatt
ccggcgctggcgctgttcccggtcactccgctggagaagaaatccttggatggggccgag
gcctggaacccagacgggatcgctcagcgcgcgatccgtgccctgcgggcgaaatttccc
gagctcggggtgatcagtgacgtcgccctcgaccccttcaccacccacggtcaggacggc
atcctcgacgagtccggctacgtgcagaacgacatcaccgtcgatgcgctggtcaagcag
gcgctgtcccatgccgaggccggtgcgcaggtggtggcgccgtcggacatgatggacggc
cgcgtgcaggcgatccgcgaagcgctggagctggccgagcacgtcaacgtgcgcatcatg
gcctattcggccaagtacgccagcgcctactacggtccgttccgcgatgcggtgggctcg
gccgcgaacctcggcaagggcaacaagctcggctaccagatggacccggccaacggcaac
gaggcgctgcatgaagtggccgccgacctggccgaaggcgccgacatggtcatggtcaag
cctggcatgccctacctggacatcctctggcgagtgaaggatgcctacaaggtgccgacc
ttcgtctaccaggtcagtggcgagtacgccatgcacatggccgcgatccagaacggctgg
ctcagcgaggcggtcatactggaatcgctcaccgccttcaaacgtgccggtgccgatggc
atcctcacctatttcgccgtacgggcggcagaactgctaaaacaagggcgatga

DBGET integrated database retrieval system