KEGG   Pseudomonas mendocina NK-01: MDS_0395Help
Entry
MDS_0395          CDS       T01473                                 

Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pmk  Pseudomonas mendocina NK-01
Brite
Enzymes [BR:pmk01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     MDS_0395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
412407..413396
Genome map
AA seq 329 aa AA seqDB search
MRTLTLLAGLCLGASAWANLPANEPVAPIAPAEITDPAKVELGKQLFFDPRLSRSGFISC
NSCHNLSMGGSDNLPSSIGHNWQQGPINSPTVLNSSLNLAQFWDGRAADLKEQAAGPIAN
PMEMAFTHVLAIDVLRSIPQYRESFKAVYQTDEITLDEVTDAIAEFEKTLVTPNSRFDLW
LKGDQQAITQTELEGYQLFKSIGCVACHNGPALGGNSFQKMGLVEPYETSNPAEGVAGLT
GKDADRFKFKVPTLRNVELTYPYFHDGAYWKLEESVDIMARLQLGRQLSTDEIGKITAFL
KTLTGEQPSFALPILPPSNNDTPRPQPFE
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcgcactctgactctgctggccggattgtgcctgggcgccagcgcctgggccaatcta
ccggccaacgaacctgtcgcgccgatcgcaccggccgagatcaccgatccggccaaggtg
gaactgggcaagcagctgttctttgacccgcgcctgtcgcgctcggggttcatctcctgc
aactcctgccacaacctgtcgatgggcggcagcgacaacctgcccagctccatcggccat
aactggcagcaaggaccgatcaattcaccgaccgtgctcaattccagcctcaatctcgcg
cagttctgggatggtcgtgctgccgatctcaaggaacaggccgctggacctatcgccaat
ccgatggagatggcgttcactcacgttctggctatcgacgtgctgcgttcgatcccgcag
taccgtgagtcgttcaaggccgtgtaccagaccgacgaaatcaccctcgatgaggtgacc
gatgcaatcgccgagttcgaaaagaccctggtcacgcccaactcgcgcttcgatctgtgg
ctcaagggcgaccagcaggccatcacccagactgaactggagggttaccagctgttcaag
tccatcggctgcgtcgcctgccacaacggcccggcgctgggtggcaactcgttccagaag
atgggcttggtcgaaccctatgaaaccagcaacccggccgagggcgtggcgggtctgacc
ggcaaggatgcggaccgcttcaagttcaaggtgccgactctgcgcaacgtcgagctgacc
tatccctacttccatgatggcgcctactggaagttggaagagtcggtggacatcatggcg
cgtctgcagctcgggcggcagctgagcaccgatgagatcggcaagatcactgcctttctg
aagaccctgactggcgagcagccgagtttcgccctgccgatcctgccgccgtctaacaat
gacacaccgcggccgcagccattcgagtga

DBGET integrated database retrieval system