KEGG   Pseudomonas mendocina NK-01: MDS_0453Help
Entry
MDS_0453          CDS       T01473                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    MDS_0453
Enzymes [BR:pmk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     MDS_0453
Transfer RNA biogenesis [BR:pmk03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    MDS_0453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
479720..480544
Genome map
AA seq 274 aa AA seqDB search
MSHPYIPKVIDLVRAAGAATLPYWRSDVAVTEKADASPVTAADLAAHHILFDGLQALAPD
VPVLSEEAADIPLAERAAWTRWWLVDPLDGTKEFIAGSEEFTVNVALIERGRVIFGVVGV
PANGRCYYGGAGLGAWRSDAPGEEAAISVRLAPAQGFTLVASKRHSSPAQETLLAGLVER
FGEPALANIGSSLKFCLLAEGNADCYPRLAPTSQWDTAAAQGVLEGAGGEVLNLAGEALT
YEARESFLNPSFLALPAAVEWRGALIELARNLQS
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcatccctatatccctaaggtgatcgacctggtacgtgctgctggcgcggcgacc
ctgccgtactggcgcagcgatgtggcggtgacggaaaaggccgatgcctcgccggtcacc
gctgccgacctggctgcgcaccatatcctgttcgatggcttgcaggcattggcgccggat
gtgccggtgctgtcggaagaggccgccgacattccactggccgagcgcgccgcctggaca
cgctggtggctggtcgatccgctcgacggcaccaaggagttcatcgccggatcagaggag
ttcactgtcaatgtcgcgctgatcgagcgtggccgtgtgatcttcggtgtggtcggcgtc
ccggccaacggtcgttgctattacggcggtgccggcctgggcgcctggcgcagtgacgca
ccgggagaggaagcggcgatcagcgtacgcctggcaccggcgcagggctttactctggtg
gccagcaagcgccattcgagcccggcgcaggaaaccctgctcgcaggcctggttgaacgt
ttcggcgagccggctctggccaatatcggcagctcactgaagttctgtctgctggccgaa
ggcaatgccgactgctacccgcgcctggcgcccacctcgcagtgggacaccgctgcggca
cagggcgtgctggaaggggcgggtggtgaagtgctgaatctggccggcgaggcgctgacc
tatgaggcgcgtgaatccttcctcaatccgtctttcctggcgctgcccgctgccgtcgag
tggcgtggcgcgttgatcgagctggcgcgcaacctacaatcctga

DBGET integrated database retrieval system