KEGG   Pseudomonas mendocina NK-01: MDS_0971Help
Entry
MDS_0971          CDS       T01473                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pmk00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pmk00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1070375..1071640
Genome map
AA seq 421 aa AA seqDB search
MDKLIITGGARLDGEIRISGAKNSALPILAATLLGDAPVTICNLPHLHDITTMIELFGRM
GIEPVIDEKLAVEVDARAIKTLVAPYELVKTMRASILVLGPMVARFGEAEVALPGGCAIG
SRPVDLHIRGLEAMGAIIDVEGGYIKAKAPEGGLRGAHFFFDVVSVTGTENIMMAATLAK
GRSVLENAAREPEVVDLANCLIAMGAKIQGAGTDTIIIDGVERLHGARFSVMPDRIETGT
YLVAAAVTGGRVKVKDADPSTLEAVLAKLQEAGAEITTGPDWIELDMKGKRPKAVNLRTA
PYPAFPTDMQAQFIALNAVAEGTGTIIETVFENRFMHVYEMLRMGANILVEGNTAVVTGV
ERLKGAPVMATDLRASASLVLAALVAEGDTLIDRIYHIDRGYECIEEKLQLLGAKIRRVP
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggataaactgatcattaccggcggcgctcgcctcgatggcgaaatccgcatttccggt
gcgaagaactctgcgctgcctattctggcggcgaccctgctgggtgatgcccccgtcacc
atctgcaacctgccgcacctgcacgacatcaccaccatgatcgagctgttcggtcgcatg
ggcatcgagccggtgatcgacgagaagctggcggttgaagttgatgcccgcgcaatcaag
accctggtcgcgccttacgagctggtaaaaaccatgcgcgcctcgattctggtgctcggc
ccgatggtcgctcgcttcggtgaggccgaggtggcgctgcctggtggttgcgccatcggt
tcacgtccggtcgacctgcacatccgtggcctcgaggccatgggtgcgatcatcgatgtc
gaaggtggctacatcaaggccaaggcgccggagggtggcctgcgcggtgcgcacttcttc
ttcgacgtggtcagcgtgaccggtaccgagaacatcatgatggccgcgaccctggccaag
ggccgcagcgtgctggaaaacgccgcgcgtgagcctgaggtggtcgatctggccaactgc
ctgatcgccatgggcgcgaagatccagggcgcgggtaccgataccatcatcatcgacggt
gtcgagcgcctgcatggtgctcgtttcagtgtgatgcccgaccgtatcgagaccggcacc
tatctggtcgccgctgccgtcaccggtggtcgcgtcaaggtcaaggatgccgacccgtcg
accctggaggctgtgctggccaagctgcaggaagcgggggccgagatcaccactggtccg
gactggatcgagttggacatgaaaggcaagcgtccgaaggccgtcaacctgcgcaccgct
ccgtacccggcgttccccaccgacatgcaggcgcagttcattgccctgaatgccgtggcc
gaaggcactggcaccatcatcgaaaccgttttcgaaaaccgcttcatgcacgtctacgag
atgctgcgcatgggcgccaatatcctggtcgaaggcaacacggcggtagtcaccggcgtc
gagagactcaaaggcgcgccagtcatggcgaccgacctgcgtgcctcggcgagtctggtg
ctggctgcgctcgtggccgagggcgatacgttgatcgaccgtatctaccacatcgaccgt
ggttatgagtgcatcgaagagaagttgcagttgctgggtgccaagatccgccgcgttccg
ggttga

DBGET integrated database retrieval system