KEGG   Pseudomonas mendocina NK-01: MDS_1005Help
Entry
MDS_1005          CDS       T01473                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    MDS_1005
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MDS_1005
Enzymes [BR:pmk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     MDS_1005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1103271..1104734
Genome map
AA seq 487 aa AA seqDB search
MPMPLNQLLPAAESGVLIRELTLDSRKVRPGDLFLAVPGTQQDGRVHIADAIARGAAAVA
FEAEGAASMHADSAVLVPVKGLAGQLSAIAGRFYGEPSRALYLVGVTGTNGKTSVSQLLA
QALDLLGQPCGIVGTLGNGFHGALEQGKHTTPDPVGVQATLASLKQAGARAVAMEVSSHG
LDQGRVAALEFDVAVFTNLSRDHLDYHGSMEAYGAAKAKLFAWPNLRCRVINLDDAFGRE
LAAQTHESRLIGYSLNDADAFLYCSEAHFDDHGVRARLVTPRGEGVLRSNLLGRFNLSNL
LAVVGALLGLDYALDEILKVLPQLQGPAGRMQRLGGGDKPLVVVDYAHTPDALEKVLEAM
RPHVEGRLVCLFGCGGDRDRGKRPLMAAVAERLADVVWVTDDNPRTEEPAQIVADIRAGF
AAPERVQFIHGRGDAIARLVAQAEAADVLVLAGKGHEDYQEIMGVRQPFSDLIEANKALA
AWEAAHA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgccgctcaatcaattactgcccgctgccgaaagcggcgtgctcattcgtgaa
ctgaccctggatagccgcaaggtgcgtcctggcgatctgttcctggccgtgccgggtact
cagcaggacggtcgcgtgcatatcgccgatgccatcgcccgtggcgctgccgctgttgcc
ttcgaggccgaaggcgctgcgtccatgcatgccgacagtgcggtactggtcccggtcaag
gggttggctggccagctctcggccatcgccgggcgtttctacggtgaaccgagccgtgcc
ctgtatctggtcggcgtcaccggtaccaacggcaagaccagtgtcagccagttgctggcg
caggcgctggatctgctcggccagccttgtggcatcgtcggtactttgggcaacggcttc
catggtgcgctggagcagggcaagcacacaacgcccgacccagtcggcgtccaggccact
ctggcctcgctcaagcaagccggtgcccgcgccgtggccatggaagtgtcttcccatggt
ctggatcagggccgtgtcgccgcgctggagttcgatgtggcggtgttcaccaacctgtcg
cgtgatcacctcgactaccacggcagcatggaggcctatggtgcagccaaggccaagctg
ttcgcctggccaaatctgcgttgccgggtgatcaacctcgatgacgccttcggccgtgag
ctggcggcacaaacgcacgagtcgcgtctgatcggctacagcctgaatgatgccgacgcc
ttcctttattgcagcgaagctcacttcgatgatcacggcgtacgcgcacgcttggtgacg
ccgcgtggcgagggcgtgctgcgcagcaatctcctcggccgtttcaacctgagcaatctg
ctggccgtggtcggtgcgctgctcgggctggactacgcactcgacgagattctcaaggtt
ctgccgcagctgcaggggccggctggccgcatgcagcgcctcggtggcggtgacaagccg
ctggtagtggtcgattacgcgcacacgccggatgcgctggaaaaagttctcgaagccatg
cgtccccacgtcgaagggcgcctggtctgcctgttcggttgcggtggtgatcgtgaccgc
ggcaaacgtccgctgatggccgcagttgccgagcgtctggccgatgtggtgtgggtgacc
gatgacaatccgcgcactgaagagcctgcgcagatcgttgccgatatccgcgccggcttc
gccgcgccggagcgggtgcagttcattcacggtcgtggcgatgctatcgcgcgtctggtc
gctcaagccgaggccgccgatgtgctggtgctggcaggcaaggggcacgaggattaccag
gaaatcatgggcgtgcgtcagccgttctccgatctgatcgaagcgaacaaggccctggcg
gcctgggaggcggctcatgcttaa

DBGET integrated database retrieval system