KEGG   Pseudomonas mendocina NK-01: MDS_1305Help
Entry
MDS_1305          CDS       T01473                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MDS_1305
Enzymes [BR:pmk01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MDS_1305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1428149..1428757
Genome map
AA seq 202 aa AA seqDB search
MVIGRLRGTLAEKQPPHLLLDVNGVGYELEVPMTTLYRLPAVGEPVTLHAHLVVREDAHL
LYGFFEKRERELFRELIRLNGVGPKLALALMSGLEVDELVRCVQAQDTAALVKVPGVGKK
TAERLLVELKDRFKAWESIPSIAPLVVEPQLAQAVSSAENDAVSALISLGYKPQEASRAV
AAVKEDGMSSEDLIRRALRGMV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtggtgatcggacgtttgcgcggcaccctggcggagaagcagccgccgcatttgcttctg
gatgtgaatggcgtcggttatgagctggaagtaccgatgacgaccctttatcgtctgcct
gcggtgggtgagccggtaaccctgcacgctcatctggtggtgcgtgaggatgcgcatctg
ctctacggttttttcgaaaagcgcgagcgcgagctgttccgcgagctgattcgtctcaat
ggcgttggccccaagctggcgctggcgctgatgtccgggctcgaggtcgatgagctggtg
cgctgcgtgcaggcgcaggacaccgcagcgctggtcaaggtgccgggagtcggcaagaaa
accgccgagcgcctgttggtcgagctcaaggatcgtttcaaggcctgggagtcgataccg
tccattgcgcccctggtggttgaacctcaactggctcaggcagtctcaagcgcggagaac
gacgccgtcagtgcgctgatatccctcggctacaagccgcaggaggccagccgagccgtt
gccgccgtcaaggaggatgggatgagcagcgaagatttgatccgacgcgcactgcgcggc
atggtttag

DBGET integrated database retrieval system