KEGG   Pseudomonas mendocina NK-01: MDS_1406Help
Entry
MDS_1406          CDS       T01473                                 

Definition
(GenBank) asparagine synthase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk00250  Alanine, aspartate and glutamate metabolism
pmk01100  Metabolic pathways
pmk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MDS_1406
Enzymes [BR:pmk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     MDS_1406
Peptidases [BR:pmk01002]
 Cysteine Peptidases
  Family C44
   MDS_1406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700
Motif
Other DBs
NCBI-ProteinID: AEB57437
UniProt: F4DWB9
Position
1528514..1530442
Genome map
AA seq 642 aa AA seqDB search
MSAIAGIVRFDGQALDRSVLQRMSSILAPYGRDAQGTWHGAGVGLVRTLLRTTPEDRYDR
QPVASADCQVVFAGRLDNRDELIAQLALDKRLGSQMADSELMAHACQRWDTLALERVEGS
YALACWQPQRRRLWLARDVMGGQPLFWHRQSGFLAFASWPKALFCVPGVPRSVDEQSVLE
QLALLPMAGCSFKDIQRVNPGEFMLVEGNQLSTHVHRCLGGGPQVRFKHDEDYVEALHEH
LQRAVSACLRSSGPVASHLSSGFDSSTVTAYAARQLAHRGERLTAYTAAPREGFAGPVPR
DRHGDESKVAAQLAGRFDNIDHVILRSSGQSPLESLEQEIDELDQSPVNPCNTLWMRAIE
RDAQARGCKVMLTGQMGNMSISYDGYPYMASLWRKGRWLQWWHELCAYQRTHPQWRRRGL
VLRTVGASMPGWLWNQVVARREGRDSGLYHYTAVNLQQATTGWLQQRAAAKGWDLNYRPW
HDGRAMRLAVLRRVDTGSALASANLRGLEMRDPTYDRRLVEFCLGVPDSQFLRDGQPRWL
LRRLMADVLPEEILEGRGKGYQFADWYEGLTADRERLREQLYRLRQHRRAAQLLDLPALE
ALLENWPEEGWADMVTIRNYRLKLLRGVAMGNFIRYAEPDNR
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccattgccggtatcgttcgttttgacggtcaagcattggatcgcagtgtattg
cagcgcatgagcagcatactggcgccatacgggcgagatgcccaaggcacttggcacggt
gctggagtcggcctggtgcgaaccttactgcgcacgacgccggaagatcggtatgaccgc
cagcctgtcgcttccgctgactgtcaggtggtgttcgctgggcgcctggacaatcgtgac
gaactgattgctcagttggcgctggacaagcgcctgggcagccagatggccgactccgag
ttgatggcccatgcttgccagcgctgggacacccttgctctcgagcgcgtcgagggcagt
tacgccctggcctgctggcaaccacagcgcaggcgtctgtggcttgcgcgtgatgtcatg
ggtgggcagccattgttctggcaccggcagtccgggttcctggcctttgcttcctggccc
aaggcgctgttctgcgtaccgggtgtcccgcgcagtgtcgacgagcagagtgtgctcgaa
cagctggccttgctgcctatggcgggttgttccttcaaggatatccagcgagtgaatccg
ggcgagttcatgctggtggaaggaaaccagctttccacacatgtccatcggtgcctgggt
ggcggcccgcaggtgcgtttcaagcatgacgaggactatgtcgaggcgctgcatgagcat
ctccagcgggccgtgtcggcctgcttacgcagcagcgggcctgtggcttcgcacctcagt
tccggcttcgacagttccaccgtaacggcctacgctgcgcgccaactggcgcacaggggc
gagcgcctgactgcctacacggcagcgcccagagaaggcttcgcagggcctgtaccgcgt
gatcggcatggtgacgaaagcaaggtggcagcccagttagcggggcgtttcgacaatatc
gatcatgtgattctgcgttcctcgggccagtcgccgctggaatccctggagcaggagatc
gacgagctggatcagtctccggtcaatccttgcaataccctatggatgcgggccatcgag
cgagatgcacaagcgcgtggttgcaaggtgatgctgaccgggcagatgggcaatatgtcc
atttcctacgatggctatccctatatggcctcgctctggcgcaaggggcgttggctgcag
tggtggcacgaactgtgtgcctatcagcgtacgcatccgcaatggcgcaggcgtggcctc
gttctgcgcacggttggcgcctctatgccgggctggctttggaatcaggtggtcgccagg
cgtgagggacgcgatagtggtctctatcactacacggccgtcaacctgcagcaggcgacg
actggctggttgcagcagcgcgccgctgccaaaggctgggatctcaattaccggccctgg
catgacggcagggccatgcgcctggccgtgttaaggcgggttgataccggctcggcgctt
gcttcggcgaatttgcgcgggctggaaatgcgcgatcctacctatgacaggcgactggtg
gagttttgcctaggggttccggattcgcagtttctgcgcgatgggcaaccgcgctggctg
ttgcgtcggctgatggctgacgtgctacccgaggagatactcgaggggcgcggcaagggg
tatcaattcgccgactggtatgaggggcttactgcagatcgtgagcgtctgcgcgagcaa
ttgtaccggctgcgtcaacaccgccgggcggcacagttactcgacctgccggctctggag
gcgctgcttgaaaactggcccgaagagggttgggccgatatggtgaccattcgcaactat
cgcctgaagctgctccggggcgtcgcgatgggcaacttcatccgctatgccgagccggat
aatcgttga

DBGET integrated database retrieval system