KEGG   Pseudomonas mendocina NK-01: MDS_1412Help
Entry
MDS_1412          CDS       T01473                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pmk00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1534106..1535962
Genome map
AA seq 618 aa AA seqDB search
MCGLVVLARWSEQASRLAMRAALDCLAHRGPDAEGMHAAWGGRLLLGHRRLAILDTNTAA
SQPMIDPLTATALVFNGAIYNYRELRAELQALGAVFSTGSDTEVILLAWRHWGMACFQRF
NGMWALAIHDGPSGKLYLSRDRLGVKPLYCRRSADCLAVASELKAVLAASQAPLRVDPAA
ALDYLSLGLLDHRPSSFLQDIIEVPPGALWCVTPDGFIEQRRFHDWPEVDPDLQCETVAK
ALPELLVDAVGLRLRSDVALAAQLSGGMDSGSVAWAIGQQRQALEHFQGFFSYGYDGEIG
QEHDETAAALRTLEHVAPGLPYHRVAAAACPQLAELEQLIAVQELPVATPSILAGWRLFR
AISATGAKVVLTGDGSDELFAGYTRRYLPLALRRALGRLDFAQAGALLASDELSYGIALR
RLVWSLPASALYGLFRRQPHMRVLREGFLNAQREALQGVIALQRQELDVQGVDDVRRVLL
PQILRYGDRNAMAWGIESRSPFLDYRIAELAMRLPASRKVGPTGGKLPLRMAMAGRLPDS
VVRGHKNRGLGNAEQYQVGHMNLTELLEAPPQAAADFIDIAQLREQLRRQPGNPRLWWPV
CFLLWLRWLETGPGRLAC
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtctggtggttctggcgcgttggtcagagcaggcgagcaggctggcaatgcga
gctgcgttggactgtctggcgcatcgcgggccggatgctgaaggcatgcatgcggcctgg
ggtggtcggctgctgctggggcatcggcgtcttgcgattctcgataccaatacggcggct
tcccagcccatgattgacccgctgacggcaaccgcgctggtcttcaatggcgcgatctac
aactatcgtgagttgcgcgctgagttgcaggcactgggcgccgttttcagcacgggctcc
gatacggaggtcattctgctggcctggcgtcattggggcatggcttgcttccagcgcttc
aatggcatgtgggcgctggcgatacacgatgggccttccgggaagctgtatctgagtcgt
gatcgccttggggtcaaacctctgtattgccggcgatcggcggattgcctggcggtggcc
agcgaactcaaggctgtgctggcagccagtcaggcgccgctaagggtcgatcccgctgcg
gcattggattacctgagcctgggcttgctcgatcatcgtccttccagtttcctgcaggac
atcatcgaggtaccacccggggcactatggtgtgtcacgccggatggcttcatcgagcaa
cgacgttttcatgactggcccgaggtcgatccagacttgcaatgcgagacggtcgccaag
gcgctgcccgagcttctcgtggatgccgtcggtttgcgtctgcgctccgatgtcgcgctt
gccgcgcagctttccggtggtatggactcgggtagcgtggcctgggccatcggccagcaa
cgccaggcgttggagcatttccagggctttttttcctatggctacgatggcgagataggc
caggagcacgacgaaacggcggcagccttgcgcaccctggagcatgtcgcgcctgggttg
ccgtatcaccgggtagcggctgccgcctgtccgcaactggcggagcttgaacaattgatc
gcggtgcaggagttgccagtggcgacgccgagcattctggcggggtggcgcctgttccgg
gctatctcggcaaccggggcgaaggtggtgctgacgggggatggcagtgatgagctgttt
gccggctatacccggcgctatctgccgttggcactgcgtcgagcgctcgggcgattggac
tttgcacaggcgggtgcacttctggcgagtgatgagctgtcatacggcattgcactgcgc
cgcttggtctggagtctgcccgcctcggccttgtatggcctgttccgccggcagccgcat
atgcgcgtgctccgtgagggctttctgaatgctcagcgagaggcattgcagggcgtgatc
gctctgcagcgccaggagctcgatgtgcagggcgtcgatgatgtgaggcgggtgctgctg
ccgcagattctgcgctatggcgatcgcaacgccatggcctggggcatcgagtcacggtca
ccattcctggactaccgtatcgccgagctggccatgcgcttgccggcatcacgcaaggta
ggacctacggggggcaagctgccgctgcgcatggcgatggctggccgtctgccggattcc
gtggtgcgtggacacaagaatcgcgggttgggcaatgccgaacagtaccaggttggccat
atgaacctgaccgaactgctcgaggcacctccgcaggccgcagcagatttcatcgacata
gcgcagctacgcgaacagctacgtcgccagccaggcaaccccagattgtggtggccggtc
tgtttcctgctttggctgcgttggctggagaccgggccgggtcgactagcgtgctga

DBGET integrated database retrieval system