KEGG   Pseudomonas mendocina NK-01: MDS_1468Help
Entry
MDS_1468          CDS       T01473                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:pmk00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1609595..1610239)
Genome map
AA seq 214 aa AA seqDB search
MKIASFDVDAQKGFTPLCPNELPVPEGDLIVPELNQLAERAQLRVGSKDAHSPQAAWVVP
DHAQMLQALPLANADLTWVSHCVPGTPGFELLDGLPAPLDYDYFVWKGVEPDLHPYGACY
HDLAEKRSTGVIEFLRQNGVDLVLVGGLALDYCVKTTALQLRRAGFEVIVYLPACRAIAS
ETAETACIAMGEHGITLAASLEQLDSVIAKENPR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgccagcttcgacgtcgacgcccagaaaggcttcacgccactttgtcccaac
gagctgccagttcccgagggggacctcatcgtccccgagctcaaccaactggcagagcgc
gctcagttgcgcgtcggcagtaaggatgcccacagcccgcaagccgcctgggtggtgccg
gaccacgcacagatgctgcaagcgctgccgctggccaatgccgatctgacctgggtcagc
cattgcgtccccggcacacctggcttcgaactgctcgacggcttgcctgcgccactggac
tatgactacttcgtgtggaagggcgtggagcccgacctacatccttacggcgcctgctac
cacgacctggccgagaagcgcagcacgggcgtgatcgaatttcttcggcaaaatggcgtc
gaccttgtattggttggcggtctggcgctggactactgcgtcaagaccaccgccctgcaa
ctgcgccgcgccggcttcgaggtaatcgtgtatctaccggcctgccgagccatcgccagc
gaaaccgccgaaactgcctgtatcgccatgggcgagcacggcatcacacttgccgccagc
ctggaacagctggacagcgtcatagccaaggagaacccgcgatga

DBGET integrated database retrieval system