KEGG   Pseudomonas mendocina NK-01: MDS_1468Help
Entry
MDS_1468          CDS       T01473                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    MDS_1468
Enzymes [BR:pmk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     MDS_1468
    3.5.1.-  
     MDS_1468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1609595..1610239)
Genome map
AA seq 214 aa AA seqDB search
MKIASFDVDAQKGFTPLCPNELPVPEGDLIVPELNQLAERAQLRVGSKDAHSPQAAWVVP
DHAQMLQALPLANADLTWVSHCVPGTPGFELLDGLPAPLDYDYFVWKGVEPDLHPYGACY
HDLAEKRSTGVIEFLRQNGVDLVLVGGLALDYCVKTTALQLRRAGFEVIVYLPACRAIAS
ETAETACIAMGEHGITLAASLEQLDSVIAKENPR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgccagcttcgacgtcgacgcccagaaaggcttcacgccactttgtcccaac
gagctgccagttcccgagggggacctcatcgtccccgagctcaaccaactggcagagcgc
gctcagttgcgcgtcggcagtaaggatgcccacagcccgcaagccgcctgggtggtgccg
gaccacgcacagatgctgcaagcgctgccgctggccaatgccgatctgacctgggtcagc
cattgcgtccccggcacacctggcttcgaactgctcgacggcttgcctgcgccactggac
tatgactacttcgtgtggaagggcgtggagcccgacctacatccttacggcgcctgctac
cacgacctggccgagaagcgcagcacgggcgtgatcgaatttcttcggcaaaatggcgtc
gaccttgtattggttggcggtctggcgctggactactgcgtcaagaccaccgccctgcaa
ctgcgccgcgccggcttcgaggtaatcgtgtatctaccggcctgccgagccatcgccagc
gaaaccgccgaaactgcctgtatcgccatgggcgagcacggcatcacacttgccgccagc
ctggaacagctggacagcgtcatagccaaggagaacccgcgatga

DBGET integrated database retrieval system