KEGG   Pseudomonas mendocina NK-01: MDS_1640Help
Entry
MDS_1640          CDS       T01473                                 

Definition
LexA repressor
Orthology
K01356  
repressor LexA [EC:3.4.21.88]
Organism
pmk  Pseudomonas mendocina NK-01
Brite
Enzymes [BR:pmk01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.88  repressor LexA
     MDS_1640
Peptidases [BR:pmk01002]
 Serine Peptidases
  Family S24: LexA family
   MDS_1640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1788756..1789370)
Genome map
AA seq 204 aa AA seqDB search
MLKLTPRQAEILAFIKRCLEDNGYPPTRAEIAQELGFKSPNAAEEHLKALARKGAIEMTP
GASRGIRIPGFEAGAANEDEGLPVIGRVAAGAPILAQQHVEESCQINPAFFQPKADYLLR
VRGMSMKDIGIFDGDLLAVHTTREARNGQIVVARIDDEVTVKRFKREGNKVWLIAENPEF
APIEVDLEHQDLVIEGLSVGVIRR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaactgacgccacgccaagccgagattctcgccttcatcaaacgctgcctggaa
gacaacggctacccgcccacccgcgcggaaatagcccaggaattggggttcaaatcaccc
aacgccgcagaagagcacctcaaggcccttgcccgcaagggcgccatcgagatgacccct
ggcgcgtcgcgcggtattcgtattcccggcttcgaggcgggcgcagcgaacgaggacgag
ggcctgccggtgatcggccgtgtcgcagccggcgccccgatcctcgcacagcagcatgta
gaggaatcctgccagatcaacccggcattctttcagcccaaggccgactatctgctgcgc
gtacgcggcatgagcatgaaggacatcggtattttcgatggtgacctgctcgccgttcat
accacccgcgaagcacgcaacggccagattgtcgttgcccgtatcgacgatgaggtgacg
gtcaagcgcttcaagcgcgagggcaacaaggtctggctgattgccgagaatcctgaattc
gccccgatcgaagtggatctggaacatcaggatctggtcatcgaaggtttgagtgtcggt
gtaatccgccgctga

DBGET integrated database retrieval system