KEGG   Pseudomonas mendocina NK-01: MDS_1640Help
Entry
MDS_1640          CDS       T01473                                 

Definition
LexA repressor
Orthology
K01356  
repressor LexA [EC:3.4.21.88]
Organism
pmk  Pseudomonas mendocina NK-01
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1788756..1789370)
Genome map
AA seq 204 aa AA seqDB search
MLKLTPRQAEILAFIKRCLEDNGYPPTRAEIAQELGFKSPNAAEEHLKALARKGAIEMTP
GASRGIRIPGFEAGAANEDEGLPVIGRVAAGAPILAQQHVEESCQINPAFFQPKADYLLR
VRGMSMKDIGIFDGDLLAVHTTREARNGQIVVARIDDEVTVKRFKREGNKVWLIAENPEF
APIEVDLEHQDLVIEGLSVGVIRR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaactgacgccacgccaagccgagattctcgccttcatcaaacgctgcctggaa
gacaacggctacccgcccacccgcgcggaaatagcccaggaattggggttcaaatcaccc
aacgccgcagaagagcacctcaaggcccttgcccgcaagggcgccatcgagatgacccct
ggcgcgtcgcgcggtattcgtattcccggcttcgaggcgggcgcagcgaacgaggacgag
ggcctgccggtgatcggccgtgtcgcagccggcgccccgatcctcgcacagcagcatgta
gaggaatcctgccagatcaacccggcattctttcagcccaaggccgactatctgctgcgc
gtacgcggcatgagcatgaaggacatcggtattttcgatggtgacctgctcgccgttcat
accacccgcgaagcacgcaacggccagattgtcgttgcccgtatcgacgatgaggtgacg
gtcaagcgcttcaagcgcgagggcaacaaggtctggctgattgccgagaatcctgaattc
gccccgatcgaagtggatctggaacatcaggatctggtcatcgaaggtttgagtgtcggt
gtaatccgccgctga

DBGET integrated database retrieval system