KEGG   Pseudomonas mendocina NK-01: MDS_1643Help
Entry
MDS_1643          CDS       T01473                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pmk00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:pmk00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1790894..1791892
Genome map
AA seq 332 aa AA seqDB search
MQGSLMMDIAGTWLTAEDRQMLRQPEVGGLIIFARNIESPRQVRELCQSIRAVRPDLLLA
VDQEGGRVQRLRQGFLRLPAMRAIADNHNAEELAEHCGWLMATEVLAVGLDLSFAPVLDL
DHQRSAVVGSRAFEGDARRATALAAAFIRGMHQAGMAATGKHFPGHGWAEADSHVAIPVD
ERSLDEIRACDMQPFKRLAGELDAVMPAHVIYPQADEQPAGFSRRWLQDILRGELGFDGV
IFSDDLSMAGAHVVGDAGKRIEAALTAGCDMGLVCNDRGSAELALSALQRLQVTPAERLQ
RMRGRGHACTDYRQVPRWSVAVAALRAAQLID
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggctctttgatgatggacatcgccggtacctggctgactgccgaggatcgccag
atgctgcgccagcccgaggtgggtggtctgatcatttttgcccgcaacatcgagtcgccg
cgccaggtacgtgagctatgccagagcattcgcgccgtgcggccggatctgctgctggcg
gtggatcaggagggtgggcgtgtgcagcgcctgcgccagggctttctgcgtttgccggcg
atgcgtgcgattgccgataaccacaacgctgaagaactggccgagcattgcggttggctg
atggcgaccgaagtgttggcggttgggctggatctgagcttcgccccggtactggacctc
gaccaccagcgtagtgcggtggtcggcagccgcgccttcgagggcgatgcgcggcgcgcc
acggcgctggctgccgcgttcattcgcggcatgcaccaggcgggcatggccgcgaccggc
aagcacttccccgggcatggctgggccgaggcggactctcacgtagccattccggtcgac
gagcgcagcctcgatgagattcgcgcctgcgacatgcagccgttcaagcgcctggctggc
gagctcgatgcggtgatgccggcgcacgtgatctatccgcaggccgatgagcagccagcg
ggtttctcgcgtcgctggctgcaagacattctgcgcggcgagttgggcttcgacggcgtg
atcttcagtgacgacctgtcgatggccggtgcgcacgtggtcggcgatgccggcaagcgt
atcgaggcggcgctcacggccggctgtgacatgggcttggtgtgcaatgatcggggctcg
gctgaactggccctcagcgcattgcagcgcttgcaggtcacgccagccgagcgcttgcaa
cgcatgcgcgggcgtggtcacgcctgcaccgattaccgccaggtgccacgctggtcggtg
gctgtggcagcgctcagagccgcgcagctgattgactga

DBGET integrated database retrieval system