KEGG   Pseudomonas mendocina NK-01: MDS_1643Help
Entry
MDS_1643          CDS       T01473                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MDS_1643
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    MDS_1643
Enzymes [BR:pmk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MDS_1643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1790894..1791892
Genome map
AA seq 332 aa AA seqDB search
MQGSLMMDIAGTWLTAEDRQMLRQPEVGGLIIFARNIESPRQVRELCQSIRAVRPDLLLA
VDQEGGRVQRLRQGFLRLPAMRAIADNHNAEELAEHCGWLMATEVLAVGLDLSFAPVLDL
DHQRSAVVGSRAFEGDARRATALAAAFIRGMHQAGMAATGKHFPGHGWAEADSHVAIPVD
ERSLDEIRACDMQPFKRLAGELDAVMPAHVIYPQADEQPAGFSRRWLQDILRGELGFDGV
IFSDDLSMAGAHVVGDAGKRIEAALTAGCDMGLVCNDRGSAELALSALQRLQVTPAERLQ
RMRGRGHACTDYRQVPRWSVAVAALRAAQLID
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggctctttgatgatggacatcgccggtacctggctgactgccgaggatcgccag
atgctgcgccagcccgaggtgggtggtctgatcatttttgcccgcaacatcgagtcgccg
cgccaggtacgtgagctatgccagagcattcgcgccgtgcggccggatctgctgctggcg
gtggatcaggagggtgggcgtgtgcagcgcctgcgccagggctttctgcgtttgccggcg
atgcgtgcgattgccgataaccacaacgctgaagaactggccgagcattgcggttggctg
atggcgaccgaagtgttggcggttgggctggatctgagcttcgccccggtactggacctc
gaccaccagcgtagtgcggtggtcggcagccgcgccttcgagggcgatgcgcggcgcgcc
acggcgctggctgccgcgttcattcgcggcatgcaccaggcgggcatggccgcgaccggc
aagcacttccccgggcatggctgggccgaggcggactctcacgtagccattccggtcgac
gagcgcagcctcgatgagattcgcgcctgcgacatgcagccgttcaagcgcctggctggc
gagctcgatgcggtgatgccggcgcacgtgatctatccgcaggccgatgagcagccagcg
ggtttctcgcgtcgctggctgcaagacattctgcgcggcgagttgggcttcgacggcgtg
atcttcagtgacgacctgtcgatggccggtgcgcacgtggtcggcgatgccggcaagcgt
atcgaggcggcgctcacggccggctgtgacatgggcttggtgtgcaatgatcggggctcg
gctgaactggccctcagcgcattgcagcgcttgcaggtcacgccagccgagcgcttgcaa
cgcatgcgcgggcgtggtcacgcctgcaccgattaccgccaggtgccacgctggtcggtg
gctgtggcagcgctcagagccgcgcagctgattgactga

DBGET integrated database retrieval system