KEGG   Pseudomonas mendocina NK-01: MDS_1873Help
Entry
MDS_1873          CDS       T01473                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MDS_1873
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    MDS_1873
Enzymes [BR:pmk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     MDS_1873
Two-component system [BR:pmk02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   MDS_1873
Bacterial motility proteins [BR:pmk02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    MDS_1873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2057170..2058294
Genome map
AA seq 374 aa AA seqDB search
MAVKVLVVDDSGFFRRRVSEILSADPSIQVVGTATNGREAIDQALALKPDVITMDYEMPM
MDGITAVRNIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDFLPKNFEDISRNPEKVKQ
MLCEKVHSIARSNRRFSSAAVAPAPTAASPSVAPISRPAVSTRPAAPAPAAPARSGGGAA
ISSAPKRKAYKLVAIGTSTGGPVALQRVLTQLPANFPAPLVLIQHMPAAFTKAFAERLDK
LCRIQVKEAEDGDILRPGLALLAPGGKQMMVDARGAVKILPGDERLNYKPCVDITFGSAA
KSYGDKVLAVVLTGMGADGREGARLLKQGGSQVWAQDEASCVIYGMPMAVVKANLADAVY
GLDDIGRHLTEACQ
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggctgttaaggttctggtggtggacgactccggcttcttccgccggcgtgtctcggaa
atcctgtctgctgaccccagcatccaggtcgtgggcacggctaccaacgggcgggaagcc
atcgatcaggcgttggcactcaagcccgacgtgatcaccatggattacgagatgccgatg
atggacggcatcaccgcagttcgaaacattatgcagcgctgtccgacgccggtactgatg
ttctcctcgctgactcatgaaggcgcgcgggtgaccctcgatgcgctggacgccggcgcg
gtggatttcctgccgaagaacttcgaagacatctcgcgcaaccccgagaaggtcaagcag
atgctctgcgagaaggtgcacagcatcgcacgcagcaaccgtcgtttcagttcggctgcg
gtagctccggcgccgactgcggccagcccgagcgtggcgccgattagtcgcccggccgtt
tcgacgcgacctgcggctcccgctcccgcagctcctgcacgtagcggtggaggggctgcg
atttcgtctgcgcccaagcgcaaggcatacaagctggtggccatcggcacgtccacaggt
ggcccggtggcgttgcagcgcgtactgacccagctgccggccaatttcccggctccgctg
gtactgatccagcacatgccggccgccttcaccaaggccttcgccgagcgactggacaag
ctgtgccgtatccaggtcaaggaagccgaggacggcgatatcctgcgccctggcctggcg
ctgctggcacctggcggcaagcagatgatggtcgatgcgcgcggcgcggtgaaaatcctg
ccgggcgatgaacgcctcaactacaagccctgtgtcgatatcaccttcggctctgccgcc
aagtcctatggcgataaggtcctggccgtggtgctgaccggcatgggcgccgatggtcgc
gaaggtgcgcgtctgctcaagcagggcggcagccaggtatgggctcaggatgaggccagt
tgcgtgatctacggcatgcccatggcggtggtcaaagccaatctggccgatgcggtctac
ggcctggacgatatcggtcgacacctgaccgaggcctgccagtga

DBGET integrated database retrieval system