KEGG   Pseudomonas mendocina NK-01: MDS_1934Help
Entry
MDS_1934          CDS       T01473                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pmk00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2122484..2123029)
Genome map
AA seq 181 aa AA seqDB search
MSLEQHYTAILGQLGEDVSREGLLDTPKRAAKAMQYLCRGYQQTLEEVTNGALFSSDNSE
MVLVKNIELYSLCEHHLLPFIGKAHVAYIPNGKVLGLSKVARIVDMYARRLQIQENLSRQ
IAEAVEQVTGALGVAVVIEAQHMCMMMRGVEKQNSSMVTSVMLGEFRTNPATRGEFLNLV
R
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgtccctggaacaacactacaccgccatcctcggtcagctcggcgaagacgtctcccgc
gaaggcctactggacacgccaaagcgtgccgccaaggccatgcagtacctttgccgcggc
taccagcagacattggaagaggtgaccaatggtgcgctgttcagctcagacaacagcgaa
atggtgctggtcaagaacatcgagctgtactcgctgtgcgagcatcacctgctgccgttc
atcggcaaggctcacgtggcctacattcccaacggcaaggtactgggcctgtccaaggtc
gcacgcattgtcgatatgtatgcccgccgtctgcagattcaggaaaacctcagccggcag
atcgccgaagcggtcgaacaggtcaccggcgccctcggtgtggcggtggtaatcgaggcg
cagcacatgtgcatgatgatgcgtggtgtggagaagcagaactcgtccatggtcacctcg
gtgatgctcggcgaattccgcaccaacccggcgacccgcggtgaattcctcaacctggtt
cgctga

DBGET integrated database retrieval system