KEGG   Pseudomonas mendocina NK-01: MDS_1943Help
Entry
MDS_1943          CDS       T01473                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    MDS_1943
Enzymes [BR:pmk01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     MDS_1943
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     MDS_1943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2130538..2131077
Genome map
AA seq 179 aa AA seqDB search
MSSLAVHLHTAPELPNKVLNHADDIASTLAAVGIDYRQVELPAELRPGCEQAEFDAAYGL
WLQALMSKEGHVQQELFNLQRNHPQKLELRARHLDEQVQASASAWLFIGGFAQLSLHLDD
YVYVLRGERGDLLNLPAGTRHWFDLGEEPHALVVRLSASEQAPVRTDDDIASRFARLGD
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcctcgccgtccatctgcataccgctccggaactgccgaacaaggtactgaac
cacgccgacgatatcgccagcaccctggcggcggtaggcatcgactatcgccaggtggaa
ctgccggccgaattgcgccccggctgcgaacaggccgagttcgacgcggcctatggcctg
tggctgcaggcgctgatgagcaaggaaggccatgtgcagcaggagttgtttaacctgcaa
cgcaaccacccgcaaaaactggagctgcgcgcgcgtcacctcgacgagcaggtacaggcg
agcgctagcgcctggttgttcatcggtggtttcgcccagctgagtctgcacctggatgac
tacgtttatgtcctacgcggcgagcgaggcgatctgctgaatctgccggctggcacgcgc
cactggttcgatctgggtgaggagccgcatgctctggtggtgcgcctgagcgccagcgag
caagcgcctgtgcgtaccgacgacgatatcgccagccgttttgcccgactcggtgattga

DBGET integrated database retrieval system