KEGG   Pseudomonas mendocina NK-01: MDS_2065Help
Entry
MDS_2065          CDS       T01473                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MDS_2065
DNA repair and recombination proteins [BR:pmk03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MDS_2065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2281480..2282079
Genome map
AA seq 199 aa AA seqDB search
MSFSPLIRQLIDSLRILPGVGQKTAQRMALQLLERDRSGGQRLAQALNAAMEGVGHCKRC
RSLSEDEVCQLCLDERRDDSVLCVVEGPMDVHAVEQTGYRGRYFVLKGHLSPLDGLGPEA
IGIPELLERIEAGAFSEVILATNPTVEGEATAHYIAQILAGKGLVASRIAHGMPLGGELE
LVDGGTLAHALAGRRPISL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcagccccctgattcgccaactgatcgactccttgcgcatcctgcccggtgtc
gggcagaagactgcgcagcgcatggccttgcagttgctcgagcgtgatcgcagcggtggt
cagcgtttggcgcaggcgctcaatgcggcgatggagggcgtgggtcactgcaagcgctgc
cgcagcctcagcgaagatgaagtttgtcagctatgcctcgacgagcgtcgtgacgacagt
gtgctctgtgtggtcgaggggccgatggacgtgcatgcggtggaacagaccggctatcgc
gggcgctatttcgtgctcaagggccacctgtcgccactcgatggtctgggtccggaagcc
atcggcattcccgaactgctggaacgcatcgaggctggcgccttcagtgaagtgatcttg
gccaccaacccgacagtagagggcgaggccacggcgcactacattgcgcagattctggcg
ggcaagggcctggtcgcctcgcgcattgctcacggcatgccgctaggtggcgaactggag
ctggtcgacggcggtaccctggctcacgccctggctggccgtcgtccgatcagtctgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system