KEGG   Pseudomonas mendocina NK-01: MDS_2116Help
Entry
MDS_2116          CDS       T01473                                 

Definition
short chain enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MDS_2116
   01212 Fatty acid metabolism
    MDS_2116
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MDS_2116
   00650 Butanoate metabolism
    MDS_2116
  Lipid metabolism
   00071 Fatty acid degradation
    MDS_2116
   01040 Biosynthesis of unsaturated fatty acids
    MDS_2116
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MDS_2116
   00310 Lysine degradation
    MDS_2116
   00380 Tryptophan metabolism
    MDS_2116
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MDS_2116
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MDS_2116
   00281 Geraniol degradation
    MDS_2116
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    MDS_2116
Enzymes [BR:pmk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     MDS_2116
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MDS_2116
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     MDS_2116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2326894..2329053
Genome map
AA seq 719 aa AA seqDB search
MTDAIRYEKGQDNIVVLTMDMPGQSANTMNAVYREAMGQIVDRLEAEKDSIAGVIVTSAK
KTFFAGGDLNELIKVTKAEAQGFYEMILKIKGQLRRLETLGKPVVAAINGAALGGGWEIA
LACHHRIALNESHVQLGLPEVTLGLLPGGGGVVRMVRLLGLEKALPYLAEGKKVRPDAAL
KAGLIHELASDRDEMLAKARAWIAANPAAKQPWDVQGYKIPGGTPSSPNVAQMLAIAPSV
LRDKTKGCFPAPEKIMCAAVEGAQVDFDTAQIIEARYFTELTCGQVAKNMIGTFWFQLNE
INAGGSRPQVYPKTQTKKVGVLGAGMMGAGIAYVSAAAGIEVVLKDVSVEAAEKGKSYSA
KLLDKKVSKGHMTAEQREAFLALITATDSEADFSGCDLIIEAVFEDRALKGKVTAAAEAA
ALSDAVIASNTSTLPITGLATAVAKPEKFIGLHFFSPVDKMPLVEIIRGEKTSDETLARG
FDYVMQIKKTPIVVNDSRGFFTSRVFGTFTNEGLAMLGEGVSAAMIENEARKAGMPVGPL
AISDEVSMSLMNHIRQQTIKDLAAEGKSIPEHPAFAVIDLMLGEYKRPGKAAGMGFYDYP
AAGAPASGKKYLWPELKARFEKADAQIAQEDVRDRILFIQAIETVRCVEEGVLKSVADAN
IGSIFGIGFAAWTGGALQFINQYGVKDFVARAQYLAEQYGERFLPPALLLEKAARGDRF
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgccatccgttacgaaaaaggccaggacaatatcgtcgtcctgaccatggac
atgcctggccagagcgccaacaccatgaacgcggtatatcgcgaggccatgggccagata
gtcgatcgtctggaagcggaaaaggattcgattgcgggggttatcgtcacctcggcaaag
aagaccttcttcgctggcggcgacctcaacgagctgatcaaggtcaccaaggccgaggct
caaggcttctacgagatgatcctgaagatcaagggtcagctacgccgcctggaaaccctc
ggtaagccggtggttgctgccatcaacggtgcggcgctgggcggcggctgggaaatcgcc
ctggcctgtcaccaccgcatcgcccttaatgagagccacgtgcaactcggtctgccggaa
gtcaccctgggtctgctgccaggcggtggcggggtggtgcgtatggtgcgtctgctcggc
ctggagaaagccctgccgtacctggccgaaggcaagaaggtgcgcccggatgcggcgctc
aaggcaggcctgatccacgagctggccagcgaccgcgatgagatgctggccaaggcccgc
gcctggatcgccgccaacccagccgccaaacagccctgggacgtgcagggttacaagatc
ccgggcggcacgcccagctcgccgaacgtggcgcagatgctggccattgctccgagcgtg
ctgcgtgacaagaccaagggctgcttcccggcgccggagaagatcatgtgcgcggcggtt
gagggggcgcaggtcgacttcgataccgcgcagatcatcgaggcgcgctacttcaccgag
ctgacctgcggccaggtggcgaagaacatgatcggcaccttctggttccagctcaatgaa
atcaatgccggcggctcacgcccacaggtctatccgaaaacccagacgaagaaggttggc
gtgctcggcgctggcatgatgggcgctggtatcgcctatgtgtcggcggcggccggtatc
gaggtggtgctcaaggacgtgtccgtcgaagcggcggagaagggtaagagctattcggcc
aagctgctcgacaagaaagtcagcaagggccacatgacggctgagcagcgcgaggctttc
ctggccttgatcactgccaccgacagtgaggctgatttttccggctgtgacctgatcatc
gaagccgtgttcgaggatcgtgcgctcaagggcaaggtcacagccgctgccgaagccgcc
gcgctgagtgacgcagtgattgcctccaacacctcgacgctgccgatcaccggcctggcc
actgccgtggctaaaccggagaaattcatcggcctgcacttcttcagtccggtcgacaag
atgccgctggtggagatcattcgtggcgagaagacctcggatgaaacgctggcgcgcggc
ttcgactacgtcatgcagatcaagaagacgccgatcgtggtcaacgacagccgtggcttc
ttcacctcgcgggtgttcggcaccttcaccaatgaaggcctggccatgctcggtgaaggc
gtcagcgcggccatgatcgagaacgaggcgcgtaaggccggcatgccggtcgggccgctg
gcgatcagtgacgaagtgtcgatgagcctgatgaaccatatccgccagcagaccatcaag
gatctggcggccgagggcaaatccattccagaacacccggcctttgccgtgatcgacctg
atgctgggtgaatacaaacgcccgggcaaagcggcgggcatgggcttctacgactaccct
gcggccggcgctccagccagtggcaagaagtacctgtggcctgagctcaaggcgcgtttc
gagaaggctgatgcgcaaatcgcgcaggaagacgtgcgcgaccgcatcctgttcatccag
gccatcgagacggttcgctgcgtggaagagggcgtcttgaagtcagtggccgatgccaat
atcggctcgatcttcggcatcggcttcgcagcctggaccggcggtgcgctgcagttcatc
aaccagtacggggtgaaggacttcgtcgcgcgtgctcagtacctggccgagcagtacggc
gagcgtttcctgccgccggcactgttgctggagaaggccgcaaggggtgacaggttctaa

DBGET integrated database retrieval system