KEGG   Pseudomonas mendocina NK-01: MDS_2257Help
Entry
MDS_2257          CDS       T01473                                 

Definition
succinate dehydrogenase subunit D
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MDS_2257
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MDS_2257
   00650 Butanoate metabolism
    MDS_2257
  Energy metabolism
   00190 Oxidative phosphorylation
    MDS_2257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2461326..2461646
Genome map
AA seq 106 aa AA seqDB search
MAQRVSAVVLAAYTLFLLGYVICNPGMGYAEWHGLFSHTAMRIFSLLALVALSVHAWVGM
WTISTDYLTPMALGKWATGVRFLFQAVCGIAMFAMFVWGVQILWGF
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaacgcgtttctgcggtcgttctcgcggcttacacgctgtttctgctgggctat
gtgatctgcaatccgggcatgggctacgccgagtggcatggtctgttctcgcataccgca
atgcgcattttcagcctgctggccctggttgcactgagcgtgcacgcctgggttggcatg
tggaccatttccaccgactacctgacgccgatggcgctgggcaagtgggcgactggtgtg
cgtttcctgttccaggccgtgtgtggcatcgcgatgttcgcgatgttcgtctggggcgtg
cagattctgtggggtttctga

DBGET integrated database retrieval system