KEGG   Pseudomonas mendocina NK-01: MDS_2257Help
Entry
MDS_2257          CDS       T01473                                 

Definition
succinate dehydrogenase subunit D
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:pmk01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pmk00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:pmk00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:pmk00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2461326..2461646
Genome map
AA seq 106 aa AA seqDB search
MAQRVSAVVLAAYTLFLLGYVICNPGMGYAEWHGLFSHTAMRIFSLLALVALSVHAWVGM
WTISTDYLTPMALGKWATGVRFLFQAVCGIAMFAMFVWGVQILWGF
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaacgcgtttctgcggtcgttctcgcggcttacacgctgtttctgctgggctat
gtgatctgcaatccgggcatgggctacgccgagtggcatggtctgttctcgcataccgca
atgcgcattttcagcctgctggccctggttgcactgagcgtgcacgcctgggttggcatg
tggaccatttccaccgactacctgacgccgatggcgctgggcaagtgggcgactggtgtg
cgtttcctgttccaggccgtgtgtggcatcgcgatgttcgcgatgttcgtctggggcgtg
cagattctgtggggtttctga

DBGET integrated database retrieval system