KEGG   Pseudomonas mendocina NK-01: MDS_2257Help
Entry
MDS_2257          CDS       T01473                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk00020  Citrate cycle (TCA cycle)
pmk00190  Oxidative phosphorylation
pmk00650  Butanoate metabolism
pmk01100  Metabolic pathways
pmk01110  Biosynthesis of secondary metabolites
pmk01120  Microbial metabolism in diverse environments
pmk01130  Biosynthesis of antibiotics
pmk01200  Carbon metabolism
Module
pmk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pmk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pmk_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MDS_2257
   00650 Butanoate metabolism
    MDS_2257
  Energy metabolism
   00190 Oxidative phosphorylation
    MDS_2257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: AEB58288
UniProt: F4DS89
Position
2461326..2461646
Genome map
AA seq 106 aa AA seqDB search
MAQRVSAVVLAAYTLFLLGYVICNPGMGYAEWHGLFSHTAMRIFSLLALVALSVHAWVGM
WTISTDYLTPMALGKWATGVRFLFQAVCGIAMFAMFVWGVQILWGF
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaacgcgtttctgcggtcgttctcgcggcttacacgctgtttctgctgggctat
gtgatctgcaatccgggcatgggctacgccgagtggcatggtctgttctcgcataccgca
atgcgcattttcagcctgctggccctggttgcactgagcgtgcacgcctgggttggcatg
tggaccatttccaccgactacctgacgccgatggcgctgggcaagtgggcgactggtgtg
cgtttcctgttccaggccgtgtgtggcatcgcgatgttcgcgatgttcgtctggggcgtg
cagattctgtggggtttctga

DBGET integrated database retrieval system