KEGG   Pseudomonas mendocina NK-01: MDS_2261Help
Entry
MDS_2261          CDS       T01473                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pmk01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pmk00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:pmk00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2467287..2468495
Genome map
AA seq 402 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKKPGEAVKRDELIVDIETDKVVIEVLAEADGVLAEII
KNEGDTVLSNELLGKLTEGGAAAPAAAAAPAQAAAPATAAGDDAILSPAARKLAEENGID
PNSIAGTGKGGRVTKEDVVAAVEAKKNAPAAAAKPAAAAAAAPVVATGDRTEKRVPMTRL
RAKIAERLVEAQSSMAMLTTFNEVDMTEVMALRSKYKDLFEKSHNGVRLGFMSFFVKAAT
EALKRFPAVNASIDGNDIVYHGYADIGVAVSSDRGLVVPVLRNAEQMSLAEIESGIATFG
KKAKDGKLSIEEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNIIQRPMAINGQVV
IRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPARLLLEI
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagccccaaccttcccggaatcggttgccgacggcaccgtggcc
acctggcacaagaagccgggcgaagcggtcaagcgcgatgagctgatcgtcgacatcgaa
accgacaaggtggtgatcgaagttctggccgaggccgatggtgtcctggctgaaatcatc
aagaacgaaggcgacaccgttctttccaacgagctgctgggcaagctgaccgaaggtggc
gctgccgccccggccgctgccgccgctccagcccaggctgctgctccggctaccgctgct
ggcgacgacgccatcctctcgccggccgcgcgcaagctggccgaagagaacggtatcgat
ccgaacagcatcgccggtaccggtaaaggtggccgtgtgaccaaggaagacgtggtcgct
gccgttgaagccaagaagaacgctccggccgccgctgccaagccggctgccgctgccgcc
gctgctccggtcgttgccactggcgaccgtaccgagaagcgtgtgccgatgacccgcctg
cgcgccaagatcgccgagcgtctggtcgaagctcagtcctccatggccatgctgaccacc
ttcaacgaagtcgacatgaccgaagtcatggctctgcgttcgaagtacaaggacctgttc
gagaagtcccacaatggcgtgcgcctgggcttcatgtcgttcttcgtcaaggctgctacc
gaggcgctgaagcgtttcccggctgtcaacgcctcgatcgacggcaacgacatcgtttac
cacggctatgccgacatcggcgttgccgtgtccagcgaccgtggcctggtggttccggtt
ctgcgtaacgccgagcagatgagcctggctgaaatcgagagcggcatcgccaccttcggc
aagaaagccaaagacggcaagctgtccatcgaagaaatgactggcggcaccttcaccatc
accaacggtggtacgttcggttcgatgatgtcgactccgatcgtcaacccgccgcaagcc
gccatcctgggtatgcacaacatcatccagcgtccgatggcgatcaacggtcaggtggtg
atccgcccgatgatgtacctggcgctgtcttacgaccaccgcctgatcgatggtaaggag
gccgtgaccttcctggtgaccatcaagaacttgcttgaagatccggcgcgcctgctgctg
gaaatctaa

DBGET integrated database retrieval system