KEGG   Pseudomonas mendocina NK-01: MDS_2261Help
Entry
MDS_2261          CDS       T01473                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MDS_2261
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MDS_2261
  Amino acid metabolism
   00310 Lysine degradation
    MDS_2261
Enzymes [BR:pmk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MDS_2261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2467287..2468495
Genome map
AA seq 402 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKKPGEAVKRDELIVDIETDKVVIEVLAEADGVLAEII
KNEGDTVLSNELLGKLTEGGAAAPAAAAAPAQAAAPATAAGDDAILSPAARKLAEENGID
PNSIAGTGKGGRVTKEDVVAAVEAKKNAPAAAAKPAAAAAAAPVVATGDRTEKRVPMTRL
RAKIAERLVEAQSSMAMLTTFNEVDMTEVMALRSKYKDLFEKSHNGVRLGFMSFFVKAAT
EALKRFPAVNASIDGNDIVYHGYADIGVAVSSDRGLVVPVLRNAEQMSLAEIESGIATFG
KKAKDGKLSIEEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNIIQRPMAINGQVV
IRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPARLLLEI
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagccccaaccttcccggaatcggttgccgacggcaccgtggcc
acctggcacaagaagccgggcgaagcggtcaagcgcgatgagctgatcgtcgacatcgaa
accgacaaggtggtgatcgaagttctggccgaggccgatggtgtcctggctgaaatcatc
aagaacgaaggcgacaccgttctttccaacgagctgctgggcaagctgaccgaaggtggc
gctgccgccccggccgctgccgccgctccagcccaggctgctgctccggctaccgctgct
ggcgacgacgccatcctctcgccggccgcgcgcaagctggccgaagagaacggtatcgat
ccgaacagcatcgccggtaccggtaaaggtggccgtgtgaccaaggaagacgtggtcgct
gccgttgaagccaagaagaacgctccggccgccgctgccaagccggctgccgctgccgcc
gctgctccggtcgttgccactggcgaccgtaccgagaagcgtgtgccgatgacccgcctg
cgcgccaagatcgccgagcgtctggtcgaagctcagtcctccatggccatgctgaccacc
ttcaacgaagtcgacatgaccgaagtcatggctctgcgttcgaagtacaaggacctgttc
gagaagtcccacaatggcgtgcgcctgggcttcatgtcgttcttcgtcaaggctgctacc
gaggcgctgaagcgtttcccggctgtcaacgcctcgatcgacggcaacgacatcgtttac
cacggctatgccgacatcggcgttgccgtgtccagcgaccgtggcctggtggttccggtt
ctgcgtaacgccgagcagatgagcctggctgaaatcgagagcggcatcgccaccttcggc
aagaaagccaaagacggcaagctgtccatcgaagaaatgactggcggcaccttcaccatc
accaacggtggtacgttcggttcgatgatgtcgactccgatcgtcaacccgccgcaagcc
gccatcctgggtatgcacaacatcatccagcgtccgatggcgatcaacggtcaggtggtg
atccgcccgatgatgtacctggcgctgtcttacgaccaccgcctgatcgatggtaaggag
gccgtgaccttcctggtgaccatcaagaacttgcttgaagatccggcgcgcctgctgctg
gaaatctaa

DBGET integrated database retrieval system