KEGG   Pseudomonas mendocina NK-01: MDS_2261Help
Entry
MDS_2261          CDS       T01473                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk00020  Citrate cycle (TCA cycle)
pmk00310  Lysine degradation
pmk01100  Metabolic pathways
pmk01110  Biosynthesis of secondary metabolites
pmk01120  Microbial metabolism in diverse environments
pmk01130  Biosynthesis of antibiotics
pmk01200  Carbon metabolism
Module
pmk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pmk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MDS_2261
  Amino acid metabolism
   00310 Lysine degradation
    MDS_2261
Enzymes [BR:pmk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MDS_2261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Ribosomal_60s RnfC_N
Motif
Other DBs
NCBI-ProteinID: AEB58292
UniProt: F4DS93
Position
2467287..2468495
Genome map
AA seq 402 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKKPGEAVKRDELIVDIETDKVVIEVLAEADGVLAEII
KNEGDTVLSNELLGKLTEGGAAAPAAAAAPAQAAAPATAAGDDAILSPAARKLAEENGID
PNSIAGTGKGGRVTKEDVVAAVEAKKNAPAAAAKPAAAAAAAPVVATGDRTEKRVPMTRL
RAKIAERLVEAQSSMAMLTTFNEVDMTEVMALRSKYKDLFEKSHNGVRLGFMSFFVKAAT
EALKRFPAVNASIDGNDIVYHGYADIGVAVSSDRGLVVPVLRNAEQMSLAEIESGIATFG
KKAKDGKLSIEEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNIIQRPMAINGQVV
IRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPARLLLEI
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagccccaaccttcccggaatcggttgccgacggcaccgtggcc
acctggcacaagaagccgggcgaagcggtcaagcgcgatgagctgatcgtcgacatcgaa
accgacaaggtggtgatcgaagttctggccgaggccgatggtgtcctggctgaaatcatc
aagaacgaaggcgacaccgttctttccaacgagctgctgggcaagctgaccgaaggtggc
gctgccgccccggccgctgccgccgctccagcccaggctgctgctccggctaccgctgct
ggcgacgacgccatcctctcgccggccgcgcgcaagctggccgaagagaacggtatcgat
ccgaacagcatcgccggtaccggtaaaggtggccgtgtgaccaaggaagacgtggtcgct
gccgttgaagccaagaagaacgctccggccgccgctgccaagccggctgccgctgccgcc
gctgctccggtcgttgccactggcgaccgtaccgagaagcgtgtgccgatgacccgcctg
cgcgccaagatcgccgagcgtctggtcgaagctcagtcctccatggccatgctgaccacc
ttcaacgaagtcgacatgaccgaagtcatggctctgcgttcgaagtacaaggacctgttc
gagaagtcccacaatggcgtgcgcctgggcttcatgtcgttcttcgtcaaggctgctacc
gaggcgctgaagcgtttcccggctgtcaacgcctcgatcgacggcaacgacatcgtttac
cacggctatgccgacatcggcgttgccgtgtccagcgaccgtggcctggtggttccggtt
ctgcgtaacgccgagcagatgagcctggctgaaatcgagagcggcatcgccaccttcggc
aagaaagccaaagacggcaagctgtccatcgaagaaatgactggcggcaccttcaccatc
accaacggtggtacgttcggttcgatgatgtcgactccgatcgtcaacccgccgcaagcc
gccatcctgggtatgcacaacatcatccagcgtccgatggcgatcaacggtcaggtggtg
atccgcccgatgatgtacctggcgctgtcttacgaccaccgcctgatcgatggtaaggag
gccgtgaccttcctggtgaccatcaagaacttgcttgaagatccggcgcgcctgctgctg
gaaatctaa

DBGET integrated database retrieval system